KEGG   Borreliella burgdorferi B31: BB_O22
Entry
BB_O22            CDS       T00012                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bbu  Borreliella burgdorferi B31
SSDB
Motif
Pfam: DUF685
Other DBs
NCBI-ProteinID: AAF07591
UniProt: Q9R344
Position
cp32-7:14331..15146
AA seq 271 aa
MADDQEKLLIDEEETVQIKDLNKVTTVNDTDLLLLDDGAASSNAITFKNFLDASKDKIFK
GEGLDYFKQIIKSTIAEELAADKDFVEKIYAKITDKLINNDSTNISNLFSKIKSRLTDSI
SSATLSRSDHLLIMPSSDTIQKTPVPKHILGVPSNLAYGSITRSTTLYPSDYENNAIFIN
MEDNDDVTLIFSKSYDNSPVYLDIEIQVKINDNRMQKKSLKLQYSDETTYNRVYEIAGPR
GLFTRIPIYKGWYVQKRASLYGDPVPDLLKL
NT seq 816 nt   +upstreamnt  +downstreamnt
atggctgatgatcaagaaaaattactaattgatgaagaagaaacggttcaaataaaagat
ttaaataaggttacgaccgttaacgatactgatcttttactgcttgatgatggagctgca
agcagtaatgctatcacctttaaaaactttttagatgcttctaaagacaaaatatttaaa
ggagagggattagactattttaagcagataattaagtctacaattgccgaagaacttgca
gctgataaagattttgtagaaaaaatttatgctaaaataacggacaaattaattaacaac
gattctactaatatttctaacctttttagtaaaattaaatcacgccttacagatagcata
tcatcagccactttatctagaagtgatcatcttttgataatgccttcatcagatactatt
caaaaaacacccgttcctaaacatatacttggagtaccatcaaatcttgcttatggcagc
ataactagaagtactacactttatccttctgactatgagaataacgcgatatttattaat
atggaagacaatgatgatgtaactcttattttttctaaaagttacgataattctcccgtt
tatcttgatattgaaattcaagtaaaaatcaatgataataggatgcagaaaaaatcatta
aaacttcagtattctgatgaaactacatacaatagggtttatgaaattgcgggcccccgc
ggactattcaccagaattcccatttataaaggatggtatgtccaaaaaagagcctccttg
tatggagatccagtcccagatcttttaaaactgtaa

DBGET integrated database retrieval system