KEGG   Borreliella burgdorferi B31: BB_R22
Entry
BB_R22            CDS       T00012                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bbu  Borreliella burgdorferi B31
SSDB
Motif
Pfam: DUF685 Nmad5
Other DBs
NCBI-ProteinID: AAF07498
UniProt: Q9S0F1
Position
cp32-4:14277..15092
AA seq 271 aa
MADDQEKLLIDEEETVQIKDLNKVTTVNNTDLLLLDDGAASSNAITFKNFLKTVNHQTFK
GEELGYFKEIIKSTIATELAADKDFIKSIYDLIVDKLIENESSKLSNLFSKIKSRLTDSI
SSATLSRSDDLLIMPSSDTIQKTPVPKHILGVPSNFTYGSITRSTTLYPSDYENKAISIN
MEDNDDVTLIFYKNYDNDPIYLDIEIQVKINDNRMQKKSLKLMYSDEITYNWVYEITGPR
GLFTRTPIYNGWYIQKRASLYGDSVPDLLKL
NT seq 816 nt   +upstreamnt  +downstreamnt
atggctgatgatcaagaaaaattactgattgatgaagaagaaacggttcaaattaaagat
ttaaataaggttacgaccgttaacaatactgatcttttactgcttgatgatggagctgca
agcagcaatgctatcacctttaaaaacttcttaaaaaccgttaatcaccaaacatttaaa
ggcgaagagctaggctattttaaagagataattaaatctacaatcgctactgaacttgca
gctgataaagattttataaaaagcatttacgatttaatcgttgacaagctaattgagaat
gaatctagtaaactttcaaatctttttagtaaaatcaaatcgcgccttacagatagcata
tcatcagccactttatctagaagtgatgatcttttgataatgccttcatcagatactatt
caaaaaacacccgttcctaaacatatacttggagtaccatcaaattttacttatggcagc
ataactagaagtactacactttatccttctgactatgagaataaagcgatatctattaat
atggaagacaatgatgatgtaactcttattttttacaaaaattacgataatgatcccatt
tatcttgatattgagattcaagtaaaaatcaatgataataggatgcagaaaaaatcatta
aaacttatgtattctgatgaaattacatacaattgggtttatgaaattacgggccctcgc
ggactattcaccagaactcccatttataacggatggtatatccaaaaaagagcctccttg
tatggagattcagtcccagatcttttaaaactgtaa

DBGET integrated database retrieval system