KEGG   Bubalus bubalis (water buffalo): 102389732Help
Entry
102389732         CDS       T05912                                 

Gene name
ACOD1
Definition
(RefSeq) cis-aconitate decarboxylase isoform X1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    102389732 (ACOD1)
Enzymes [BR:bbub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     102389732 (ACOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 102389732
NCBI-ProteinID: XP_006054168
Position
13
AA seq 471 aa AA seqDB search
MMLQSVTESFAKVIHGLKVGHLTDRVIQRSKRMVLDALGVGLLGTSTEVFHKASGYSKIY
SSNVSSTVWGQPELRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLMALSEALP
PSPKYSGLDLLLAFNVGIEVQGRLLRFSKEAYDIPKRFHPPSVVGTLGSAAAASKFFGLS
VTECQEALAIAVSHAGAPMANAATQTKPLHVGNAARHGLEAAFLAMLGLQGNKRVLDLET
GFGAFYTNYSPKVLPDLDSHTWLLEKQDVAFKRFPAHLATHWVADTAASMRRHLVTDKGP
LPIDRIERIVLRVPDVQYVNRPFPKSEHEARHSFQYVACAMLLDGVITVPAFHKRQINRP
QVRELLGKVELEHPRDNLPNFNTLYCEMSVALKDGAVFTERSDTFYGHWRKPLSQKDLQE
KFRANSCRTLSCHAIERLIEIVENLEDLEDCSVLTTLLKETSPPKIASKSI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgatgctccagtctgtcacagaaagctttgccaaagtgatccacggcttgaaggtggga
cacctgacagatcgtgtcattcagcggagcaagaggatggttctggatgctctgggagtg
gggctcctgggaaccagcacagaagtgtttcacaaagccagtggatacagtaaaatctat
agttccaatgtatccagcactgtttggggccagccagaactcaggctcccaccaacctat
gctgctttcgttaacggtgtggctatccactcaatggattttgatgacacgtggcaccct
gcaacccacccttctggagctgtccttcctgtcctcatggctctatcagaagccctgcca
ccaagtccaaagtattctggccttgacctgctgctggctttcaatgttggtattgaagtg
caaggccgattactgcgtttctccaaagaagcctatgacataccaaagagattccatccc
ccctcggtggtgggaaccttggggagtgctgctgccgcatctaagttttttgggctcagc
gtgacagagtgccaagaggccctggctattgctgtttctcatgctggggcacccatggca
aatgctgccactcagaccaagccacttcacgtgggcaatgctgccaggcatgggctagaa
gctgctttcctggcaatgctgggtctccagggaaacaaacgggttttggatttggagaca
gggtttggggccttctataccaactattctcctaaagtccttccagacctagattcacac
acttggcttctggagaagcaggatgtggccttcaagcgtttccctgcccatttggccacc
cactgggtggcagacacagctgcatccatgagaaggcaccttgtaacagacaaaggccca
ctccccattgaccgcattgaaagaattgtgcttcgagttccagatgtccagtatgtgaac
aggcccttccccaaatccgagcatgaagcccgccactccttccagtatgtggcctgtgcc
atgctgctcgacggtgtcatcactgtcccagccttccacaaacgccagatcaacaggcca
caggtgagagagctgcttggtaaggtggagctggagcaccctcgagacaacctaccaaac
ttcaacacactgtactgtgagatgagtgttgccctcaaggatggagccgtcttcacagag
cgttcggataccttctacggtcactggaggaagcctctgagccagaaggacctacaggaa
aagttcagagccaattcctgcaggacgctgtcctgccacgctatagaaaggcttatagag
atagtagaaaacctagaagacctggaagactgctctgtgctaaccacacttctaaaagaa
acctctccaccaaagatagcttcaaaatctatctag

DBGET integrated database retrieval system