KEGG   Bubalus bubalis (water buffalo): 102390844
Entry
102390844         CDS       T05912                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102390844 (AHRR)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102390844 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 102390844
NCBI-ProteinID: XP_006053549
Position
19
AA seq 696 aa
MIPPGECLYAGRKRRKPVQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQERCPRQPAAAAPSPGDRGPRGGSAGSAVLEGRLLLE
SLHGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFFRQLHWAMDP
PQAGCGQPLLSEAGEDAVLGRLLRAQEGDTDPPTEYSAFLTRCFICRVRCLLDSTSGFLT
MQFQGRLKFLFGQNRRAPSGAALLPRLALFCVAAPLALPPSMEVRMKTVYLRAKHRADVP
ASTDAKAKAASSLCESELLGNPNYSAGRSNGENGLSLFRTPEDACRWGRVTARVPCLCLR
GGPDLVLDPKGTTGAEEGEELGGLPRDAPPYSCRLEPLGPVKHLDWAAGRHGQDDGSTKL
KLEPGKADPFPTAPARGACLPYLGAQGAVHSLRSSPSSHPPRPPPGACAGRTSRALRDGH
QGPAPPPTPSPFPQGGLDSRVPRPAVQRLPVGGYPAEDKLRGLLMPPGAPSHPALSLDVP
IKMESDSGSEDAADGYCVSPTQMWLGAGNPAKRQLVTFPTRMHLKTEPGARLPLYTPPPG
PGLLGAPPRPGRGLAPLQPTSCACLEPPPRLCMRGHQPFNLGCNCRAPGPAPAVKLEPLD
SPLWAAHGQGGPPGLFSKSAQAAGMPPRDAQRAFLP
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgatcccaccgggggagtgcctgtacgccgggaggaaacgcaggaagcccgttcagaaa
cagaggcctgccgtgggcgctgagaagtcgaacccttccaagcggcaccgggaccgcctc
aatgccgagctggaccacctggccagcctgctgccgctgccgcccgacatcatctctaag
ctcgacaagctttctgtcctgcgtctcagcgtcagctatctcagggtgaaaagcttcttc
caagccctgcaggagaggtgcccgaggcagccggcggctgctgccccctcgccgggagac
cggggtccacgtggagggtctgcaggctcagccgtgctggagggaaggctgctgctggag
tccctccacggcttcgctctggtggtgagcgcggaagggatgatcttctacgcatcggcc
acgatcgtggactacctgggcttccaccagacagatgtgatgcaccagaatatttatgac
tacatccacgtggatgaccgccaggacttcttccggcagctgcactgggccatggaccct
ccccaggcagggtgcgggcagccgctgctctcggaggcaggagaggatgccgtcctgggg
aggctgctccgggcccaggagggggacacagacccgcccaccgagtactcggccttcctg
acacgctgcttcatctgccgcgtgcgctgcctgctggacagcacctcgggcttcctgacg
atgcagtttcaaggacgactgaagttcctcttcggtcagaacaggcgggcgccctcgggc
gcggccctgctcccgcggctggccctgttctgcgtggcagcccccctggccctgccgccc
agcatggaggtgagaatgaagaccgtgtacctgagggcgaagcacagggcggacgtcccg
gcctcaaccgacgcaaaagcaaaagctgcctcaagtctctgcgaatcagaattgcttgga
aaccccaattactcagcagggagaagcaatggagaaaacggcctctccttgttcaggaca
ccagaggacgcctgccgctggggccgggtcacagcccgggtcccctgcctgtgcctccgg
ggcggccctgaccttgtccttgaccccaagggcaccacaggggcagaggaaggagaggag
ctcggggggctcccgcgggatgcgcccccttacagctgccgcctggagcccctgggccct
gtgaagcacctggactgggcggccgggaggcatggtcaggacgatggcagcaccaagctg
aagctggagcccggcaaggctgacccgttccccaccgccccggcccgcggcgcctgcctg
ccctacctgggtgcgcaaggcgctgtccactccctccggagctcacccagctctcaccca
cccaggccgccccccggggcctgtgccggccggaccagcagagccctgcgggacgggcac
cagggcccagcgccgccccccacacccagccccttcccccaggggggcctggacagcagg
gtccctcggccggcagtccagcgtctcccggtgggcggctaccctgctgaggacaagctg
cgaggccttctgatgcccccgggagccccgagtcaccccgcgttgtcgctcgatgtgccc
atcaagatggagagtgactcagggtccgaggacgcagctgatggctactgcgtgtcccca
acccagatgtggctgggggctggcaatccggccaagagacagctggtcaccttcccgacc
aggatgcaccttaagacggagccaggcgccaggctccccctgtacaccccacccccaggg
cctggcctgctgggcgcccccccaagacccggcaggggactggccccgctgcagcccaca
tcctgtgcctgcctggagcccccgccccgcctctgcatgcggggccaccagcccttcaac
ctgggctgcaactgccgggctcccgggccagctccggcagtcaagctcgagcccctggac
tcgcccctgtgggcagctcacggccagggcgggccacctgggctgttctccaagagcgcc
caggcagcggggatgccccccagggacgcgcagcgcgccttcctgccctag

DBGET integrated database retrieval system