KEGG   Bubalus bubalis (water buffalo): 102392554
Entry
102392554         CDS       T05912                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bbub01002]
    102392554 (ERAP1)
Enzymes [BR:bbub01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102392554 (ERAP1)
Peptidases and inhibitors [BR:bbub01002]
 Metallo peptidases
  Family M1
   102392554 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Other DBs
NCBI-GeneID: 102392554
NCBI-ProteinID: XP_006064509
Position
9
AA seq 982 aa
MPALCPPCWWCGHLTFAETTGSCREVETSSFDDCTAISSKMISPSIKWPLGTRPSLLSTL
LILLTVATPSSCQSREPTSPKASNGAPFPWNKMRLPEHIIPAHYDLMIHANLTTLTFGGT
TQIEITPSKPTSTIILHSHRLQISKAALRKGGGERQAEEPLRVLENPPQEQIALLASEPL
VVGLPYTIVINYAGNLSESFHGFYKSTYRTKEGEVRVLASTQFEPTAARMAFPCFDEPAF
KASFLIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTVKMSTYLVAFIVSDFKSVSK
MTKSGIKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIPYPLPKQDLAAIPDFQSGAM
ENWGLTTYRESSLLFDAEKSLASSKLGITMTVSHELAHQWFGNLVTMEWWNDLWLNEGFA
KFMEFVSVSVTHPELKVEDYFFDKCFDAMEVDALNSSHPMSTPVENPAQIREMFDEVSYD
KGACILNMLRDYLGADAFKSGIVKYLQKYSYKNTKNEDLWNSMASICPTDDTQHMDGFCS
RGEHSSSTAHWRQEGLDVKTMMNTWTLQKGFPLITITVRGRNVHMKQEYYVKGVADATET
GFLWHVPLTFITSKSDAVQRFLLKTRTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDS
LTGLLKGTHTAISSNDRASLINNAFQLVSIGKLSIEKALDLTLYLKHETEIMPVFQGLNE
LIPMYKLMEKREMNEVETQFKAFLIRLLRDLIDKQTWTDEGSISERMLRSQLLLLACVRK
YQPCVQKAEGYFRQWQEAGGNLSLPNDVTLAVFAVGAQTLEGWDFLYSKYQSSLSSTEKN
QIEFALCISQNKEKLQWLLDQSFKGDVIKTQEFPDILRAIGRNPVGYPLAWQFLRENWNK
LVQKFELGSNSIAYMVTGTTNQFSTRARLEEVKEFFSSLKENGSQLRCVQQTIETIEENI
RWMDKNFDKIRAWLQNEKLNLL
NT seq 2949 nt   +upstreamnt  +downstreamnt
atgcctgctttgtgtcctccctgctggtggtgtggacacctcacttttgctgaaacaaca
ggaagttgcagggaagtagagacctcctcctttgatgactgcacagccatttcaagcaag
atgatatctccatccatcaaatggccacttggaaccaggccctcactgctttcaacactg
ctgattctcttaacggtggcaactccatcctcatgtcagagcagggaaccaacatctcca
aaagctagcaacggggcaccatttccttggaataaaatgcgacttccagagcacatcatc
ccagctcattatgatctcatgattcacgcaaacctcaccactctgactttcgggggaacc
acacagatagaaatcacacccagcaagcccaccagtaccatcatcctgcacagtcaccgc
ctacaaatatccaaggccgccctgaggaagggaggtggcgagaggcaggcggaagagcca
ctgagagtcctggaaaacccgcctcaggagcaaattgcacttctggcttctgagccgctg
gtcgtcggcctcccatacactattgtcatcaactatgctggcaatctttctgagagtttc
catggattttataaaagtacctacagaaccaaggaaggagaagtgagggtacttgcatca
acacagttcgaaccaactgcagccagaatggcctttccctgctttgatgaacctgctttc
aaggcgagttttttaatcaagatcagaagggaaccaagacaccttgccatctccaatatg
ccactggttaaatctgtgactgtggctgaaggactcatagaagaccactttgacgtcacc
gtgaagatgagcacctacctggtggccttcattgtttcagattttaagtctgtcagcaag
atgaccaagagcggaatcaaggtttccgtatatgctgttccagacaagataaatcaggca
gattatgcactggatgccgcagtgactcttctagaattttatgaggattatttcagcatc
ccatatccgttacccaaacaagatcttgctgcgattcctgacttccagtctggtgcaatg
gaaaactggggactgacgacatacagggaatcttctctactgtttgatgctgagaagtct
ttagcctcaagtaagctcggcatcacgatgactgtgtctcatgaactcgcccaccagtgg
tttgggaacctcgtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagttcgtgtcagtcagtgtgactcatccagaactgaaagttgaagattat
ttctttgataagtgttttgatgcaatggaggtggatgcattaaactcctcacaccccatg
tccacacccgtggagaaccctgctcagattcgggagatgtttgatgaagtttcttatgac
aagggagcttgtattctgaatatgctaagggactatcttggtgctgatgcatttaaaagc
ggcattgtaaagtatctgcagaagtatagctataaaaacacgaaaaacgaggacctgtgg
aatagtatggcaagcatttgccctacagatgacacacaacacatggatggattttgttct
agaggtgaacattcatcttcaaccgcgcactggcgacaggaaggccttgatgtgaaaacc
atgatgaacacctggacgctgcagaagggtttccccctgataaccatcactgtgagaggc
aggaacgtacatatgaagcaagagtactatgtgaaaggtgtggccgatgccacagaaacc
gggttcctgtggcatgtcccactgacattcattaccagcaaatcagacgcagtccaacgc
tttttgctgaagacaagaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtcggaatgaatggctattacattgtgcattatgaggatgatggatgggactct
ctgactggccttttaaaaggaacgcacacagcaatcagcagtaacgatcgggccagtctc
attaacaatgcatttcagcttgtcagcattggaaagctgtcaattgaaaaagccttggat
ttaaccttgtacctgaagcatgaaactgaaatcatgccagtgtttcaaggtttgaatgag
ctgataccgatgtataagttaatggagaagagagagatgaatgaagtggaaactcaattc
aaggcctttctcatcaggctgctgagggacctcattgacaagcagacgtggacagatgag
ggctccatctcggagcgaatgctgcggagtcagcttctcctccttgcctgcgtgcgcaag
taccagccctgcgtgcagaaggcagaaggctatttcagacagtggcaggaagccggtgga
aacctcagcctgcccaacgatgtgaccttggcagtgtttgctgtgggggcccagaccctc
gaaggatgggattttctttatagtaaataccagtcgtcattgtccagtaccgagaaaaac
caaattgaatttgctctctgtatcagccaaaataaagaaaagcttcagtggctactagat
caaagttttaagggagatgtaataaaaactcaagagtttccagatattcttagagctatt
ggcagaaacccagtgggatatccgttggcctggcagtttctgagggaaaactggaacaaa
cttgtacaaaagtttgaacttggctcaaattccatagcctacatggtaacgggaacaaca
aatcagttctcaacaagagcacggctcgaagaggtaaaagaattcttcagctctttgaag
gaaaacgggtctcagctccgttgtgttcaacaaaccatcgaaactatcgaggaaaacata
cgttggatggataagaattttgataagatcagagcgtggctgcaaaatgagaagcttaat
ctgctataa

DBGET integrated database retrieval system