KEGG   Bubalus bubalis (water buffalo): 102392700Help
Entry
102392700         CDS       T05912                                 

Gene name
CACNA1I
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04010  MAPK signaling pathway
bbub04020  Calcium signaling pathway
bbub04713  Circadian entrainment
bbub04925  Aldosterone synthesis and secretion
bbub04927  Cortisol synthesis and secretion
bbub04929  GnRH secretion
bbub04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102392700 (CACNA1I)
   04020 Calcium signaling pathway
    102392700 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    102392700 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    102392700 (CACNA1I)
   04927 Cortisol synthesis and secretion
    102392700 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102392700 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102392700 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bbub04040]
    102392700 (CACNA1I)
Ion channels [BR:bbub04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102392700 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 102392700
NCBI-ProteinID: XP_025138262
Position
4
AA seq 2143 aa AA seqDB search
MGWISVLVVGEWPPSCCVLDLVRTWFECISMLVILLNCVTLGMYQPCDDMDCLSERCKIL
QVFDDFIFVFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLS
AIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLL
RNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCL
SKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVIT
LEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQ
RQRYLSSSTVASYAEPGDCYEEIFQYICHILRKAKRRALGLYQALRSRRQAPGTPGSATP
GPRAKEPRHYKLCPRHSPLDPTPHTLVQPISAMLASDPASCPRCQHETDRRPSGPGSSSD
SGQEGSGSGDAGGSEDEACADSARTSEDGASSELGKEDEEGPADRAAWLCEDVWRETRAK
LRGIVDSKYFNRGIMMAILVNTVSMGIEHHQQPEELTNILEICNVVFTSMFALEMLLKLA
AFGLFDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQL
VVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIV
TVFQILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDAN
RSYSDEDQSSSNMEEFDKLQEGLDCSGDPKLCPIPMTPNGHLDPNLPLGGHLGPTGAAAS
APRLSLQPDPVLMALGSRKSSVMSLGRVSYDQRSLSSSRSSYYGPWGRSGAWASRRSSWN
SLKHKQPSAEHESLLSSERGGARGCEGTRDEGPLRTAPLHAPHAHHAHHGPHPAHRHRHH
RRTLSLDTRDSVDLAELVPAVGTHSRAAWRVAGPAPGHEDCNGRMPSIAKDVFTKMDDRR
DRGEDEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFD
YVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQ
AYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLK
LVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAAN
YRWVHQKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVPNHNPWMLLYFIS
FLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATY
CPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLE
AVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIA
RVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCE
GMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSF
VLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELELAHGLGPSPRPPASALGASV
PAHGPGGAASEGDPEGRLRRSCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFYH
YSSPAGCEKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPAACPVGPRDGKGEP
DPPEPMRVGDLGECFFPLPNTAVSSGPENFLCEMEAIPFNPVQSWLKHESSQAPQSPFSP
DASSPLLPMPAEFFHPAVAASQEGQEKGARAGTLPKIALQGSWASLRSPSVNCTLLRQAT
GSDTSLEVSRSSSAGSLQTTLEDSLTLSDSPRRGLGLPASVPGPRAGPSPAARRRPSPRG
RGTFSLRGLRAHQRSHSSGGSTSPGCTRHDSMDPSDEEGAGGRAGGGCGGAGSEHSETLS
SLSLTSLFGPPPPPPGLPPARRFSSASSLAAGPGRPRAAAAPGPRGLARSPSWAAADRCK
DPPRPAEPAAPRDPEAPEPQPPPPPPPPLGEPPSGDAASQGRR
NT seq 6432 nt NT seq  +upstreamnt  +downstreamnt
atggggtggatatctgtgttggtggtgggggagtggccccccagctgttgtgtccttgac
ttggtgcgcacgtggtttgaatgtatcagcatgctggtgatcctgcttaactgcgtgacc
ctcggcatgtaccagccgtgcgacgacatggactgcctgtcagagcgctgcaagatcctg
caggtctttgatgacttcatctttgtcttctttgccatggagatggtgctcaagatggtg
gccctgggcatttttggcaagaagtgctaccttggggacacatggaaccgactggatttc
ttcattgtcatggcagggatggtcgagtactccctggacctccagaacatcaacctgtcg
gccatccgtaccgtgcgcgtcctgaggccgctcaaagccatcaaccgtgtgcccagtatg
cggatcctggtgaacctgctcctggacacactgcctatgctggggaatgtcctcctgctc
tgcttctttgtcttcttcatctttggcatcatcggcgtgcagctctgggctggcctgctt
cgcaaccgctgcttcctggaggagaacttcaccatacaaggggacgtggctctgcccccc
tactaccagccggaggaggacgacgagatgcccttcatctgctccctgtcgggggacaac
ggcatcatgggctgccacgagatccctccgctcaaggagcagggccgcgagtgctgcctg
tccaaggacgacgtctacgacttcggggcgggccgccaggacctcaacgccagtgggctc
tgcgtcaactggaaccgctactacaatgtgtgccgcacgggcagcgccaacccccacaag
ggcgccatcaactttgacaacatcggctatgcctggatcgtcattttccaggtgatcact
ctggaaggctgggtggagatcatgtactatgtgatggatgctcactccttctacaacttc
atctattttatcctgctcatcatagtgggctccttcttcatgatcaacctgtgcctcgtt
gtcatagcgacccagttctcggagaccaagcagcgggagcaccggctgatgctggagcag
cggcagcgctacctgtcctccagcacggtggccagctatgctgagcccggcgactgctac
gaggagatcttccagtatatctgccacatcctgcgcaaggccaagcgccgcgccctgggc
ctctaccaggccctgcggagccggcgccaggccccggggacgcccggctccgccacgccc
gggccccgcgccaaggagcccaggcactacaagttatgcccccgacacagccccctggac
ccgacgccccacacgctggtgcagcccatctctgccatgctggcctccgaccctgccagc
tgcccccgctgccaacacgagaccgaccggcgaccctcaggcccaggcagcagcagcgat
tcgggccaggagggctcgggctccggggacgcagggggcagcgaggatgaagcctgtgcg
gatagtgcccggaccagcgaggacggggcctcctcggagctggggaaggaggacgaggag
gggccggccgacagggcagcctggctgtgcgaagacgtgtggcgggagacgcgagccaag
ctgcggggcattgtggacagcaagtacttcaaccggggcatcatgatggctattctggtc
aacaccgtcagcatgggcatcgagcaccatcagcagcctgaggagctgaccaacatcctg
gagatctgcaatgtggtcttcaccagcatgtttgccctggagatgctgctgaagctggcc
gccttcgggctcttcgactacctgcgcaacccctataacatcttcgacagcatcatcgtc
atcatcagcatctgggagatcgtggggcaggcggacggcgggctgtcggtgctgcggact
ttccggctgctgcgggtgctgaagctggtgcgctttatgcccgcgctgcggcgccagctc
gtggtgctcatgaagaccatggacaacgtggccaccttctgcatgctgctcatgctcttc
atcttcatcttcagcatcctcgggatgcacatctttggctgcaaattcagcctgcgcacg
gacacgggagacacagtccctgacaggaagaacttcgactccctgctgtgggccatcgtc
acggtgttccagatccttacccaggaggactggaacgtcgtcctctacaacggcatggct
tccacctccccctgggcctccctctacttcgttgccctcatgacctttggcaattatgtg
ctcttcaacctgctggtggccatcctggtggagggcttccaggcggagggtgatgccaat
cgctcctactcggacgaggaccagagctcatccaacatggaggagtttgacaagctccag
gagggcctggactgcagtggagatcccaagctctgcccaatccccatgacccccaatggg
cacctggaccccaatctcccactgggtggacatctgggccccactggggctgcagcatct
gccccccgcctctcactgcagccagaccccgtgctaatggccctgggctcccgcaagagc
agtgtcatgtcactggggagggtgagctacgaccagcgctccctgtccagctctcggagc
tcctactacgggccgtggggccgcagcggggcctgggccagccgtcgctccagctggaac
agcctcaagcacaagcaaccatcggcggagcatgagtccctgctctcctctgagcgtggc
ggcgcccggggctgcgagggcacccgggacgagggcccactacggaccgcgcccctgcac
gctccgcatgcccaccacgcgcatcatggtccccacccggcacatcgtcaccgccaccac
cgccgaacgctgtccctcgacaccagagattcagtggacctggccgagctggtgcccgcc
gtgggcacccactcccgggcggcctggagggtggcgggcccggcccccgggcacgaggac
tgcaatggcaggatgcctagcatcgccaaggacgtcttcaccaagatggatgaccgccgg
gatcgcggggaggacgaggaggagatcgactacactctgtgcttccgagtccgcaagatg
attgacgtctacaagcctgactggtgtgaagtccgtgaggactggtccgtctacctcttc
tcccccgagaacaggttccgggtcctgtgtcagaccatcattgcccataagctctttgac
tatgtcgtcctggccttcatcttcctcaactgcatcaccatcgccctggagcggccccag
attgaggccggcagcaccgaacgcatcttcctcactgtgtccaactacatcttcacagct
atcttcgtgggcgagatgacactgaaggtggtctcgctgggcctgtacttcggggagcag
gcgtacctgcgcagcagctggaacgtactggacggcttcctcgtcttcgtgtcaatcatt
gacattgtggtgtccgtggcctcggctgggggagccaagatcctgggcgtcctccgggtc
ctgcggctcctgcgcaccctacgacccctgcgtgtcatcagccgggcacctggcctgaag
ctggtggtggagacgctcatctcctccctaaagcccatcggcaacatcgtcctcatctgc
tgcgccttcttcatcatcttcggcatcctgggggtgcagctcttcaagggcaagttctac
cactgtctgggtgtagacacccgcaacatcaccaaccgctccgactgcgtggctgccaac
taccgctgggtccatcagaagtacaacttcgacaatctgggccaggccctcatgtccctc
ttcgtgctggcctccaaggatggctgggtgaacattatgtacaatggactggatgccgtc
gcagtggaccagcagcccgtgcccaaccacaacccctggatgctgctctacttcatctcc
ttcctgctcatcgtcagcttcttcgtgctcaacatgttcgtgggcgtcgtggtggagaac
ttccacaagtgccggcagcaccaggaggccgaggaggcacggcggcgcgaggagaagcgg
ctgcggcggctggaaaagaagcgccggaaggcccagcggctgccctactacgctacctac
tgtcccacgaggctgctcatccactccatgtgcaccagccactacctggacatcttcatc
accttcatcatctgcctcaatgtggtcaccatgtccctggagcactacaaccagcccacg
tctctggagacagccctcaagtactgcaactacatgttcaccactgtctttgtgctggag
gctgtgctgaagctggtggcatttggtctgagacgcttcttcaaggaccggtggaaccaa
ctggacctggccatcgtgctgctgtcggtcatgggcatcacgctggaggagattgagatc
aacgcggcgctgcccatcaaccccactatcatccgaattatgcgggtcctgcgcatcgcc
cgggtgctgaagctcttgaagatggccacgggaatgcgggccctgctggacaccgtggtg
caagctctaccccaggtgggcaacctgggcctcctcttcatgctgctcttcttcatctac
gccgccctgggagtggagctcttcgggaagctggtctgcaacgacgagaacccttgtgag
ggcatgagccggcacgccaccttcgagaatttcggcatggcctttctcacgctctttcag
gtctccactggcgacaactggaacgggatcatgaaggacacactgcgggactgcacgcac
gacgagcgcagctgcctgagcagcctgcagttcgtgtcaccgctgtacttcgtcagcttc
gtgctcacggcccagttcgtgctcatcaacgtggtggtggccgtgctcatgaagcacctg
gacgacagcaacaaggaggcccaggaggacgccgagatggacgccgagctggagctggag
ctggcccacggcctgggccccagcccgcggccacctgccagtgccctgggggcgtccgtg
cccgcccacgggccgggaggggcggccagcgagggtgaccccgagggccgcctgcgccga
agctgctactcaccagcccaggagaacctgtggctggacagcgtctctttaatcatcaag
gactccttggagggggagctgaccatcatcgacaacctgtccgggtccatcttctaccac
tactcctcgccggccggctgcgagaaatgtcaccacgacaagcaggaggtgcagctggcc
gagacggaggccttctccctgaactcagacaggtcctcgtccatcctgcttggcgatgac
ctgagtctggaggaccctgcagcctgccctgtcggccccagggacggcaagggcgagcct
gacccgcctgagcccatgcgggtaggggacctgggcgaatgcttcttccccttacccaac
acggccgtctcatcgggtccggagaacttcctgtgcgagatggaggccatcccattcaac
cccgtccagtcctggctgaaacacgagagcagccaagcgcctcagagccccttctccccg
gatgcctccagcccgctcctgcccatgccggcggagttcttccaccctgccgtggccgcc
agccaggaagggcaggagaagggcgccagagccgggaccctccccaagatcgccctgcag
ggctcctgggcctccctgcggtcgcctagcgtcaactgcaccctccttcgacaggccacg
gggagcgacacgtcgctggaggtcagccgcagcagctcggcgggcagcctgcagaccacg
ctggaggacagccttaccctgagcgacagcccgcggcgagggctggggctgcccgcgtcc
gtcccggggccccgcgccggcccgtcgcccgctgcgcgccgccgcccgagcccgcggggc
cggggcacgttcagcctgcgcgggctgcgggcgcaccagcgcagccacagcagcgggggc
tccaccagcccgggctgcacgcggcacgactccatggacccctcggacgaggagggcgcg
ggcggccgggccggcgggggctgcgggggcgcgggcagcgagcactcggagaccctcagc
agcctctcgctcacctccctcttcgggccgccgcccccgccgcccggcctcccgcccgcg
cgccggttcagcagcgccagcagcctggccgccgggcccggccgcccccgcgccgccgcc
gcccctgggccccgcggcctggcccgcagcccctcctgggccgccgccgatcgctgcaag
gacccgccgcgcccggccgagccggccgctccccgagaccccgaggcgcccgagccacag
cccccgccgccgccgccgccgccgctgggggagccgccgtccggggacgccgcgagccag
gggaggagatga

DBGET integrated database retrieval system