KEGG   Bubalus bubalis (water buffalo): 102392815
Entry
102392815         CDS       T05912                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bbub01009]
    102392815 (AKAP5)
Protein phosphatases and associated proteins [BR:bbub01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102392815 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102392815
NCBI-ProteinID: XP_006072233
Position
11
AA seq 427 aa
MEITVSEIQVESKDETRSAEVRPQDERQEEKASMLCFKRRKKAAKAMKPDASSKAADAAK
KCPPEARASDQPQRPGRAWDSIKRLVTRRKRSESSKQQKPFKAKLQTEINAEDANPSKKK
VKSRLKIPCIKFSKGEKRSNHSKIIEDSDRSVKVQEAENLVTKTQTQSDDQATKSKSPQD
VREDVSQKGDNEVCESNVNSSITSPGEKVISVELELDMGHSAIQTGTLILENTEMLEEKQ
SIQPQHVSPLEASDTEQELPVGSEVPPSPAVPDQQILEEARNGVLDSGPDWKEHESIEIV
VEESKPKDTELSQELDFQENEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVPK
PFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
TINNCLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagatcacagtttctgaaatacaagtagaaagcaaggatgagacgagatcagcagaa
gttagacctcaggatgagaggcaggaggaaaaagcatcaatgctttgcttcaagagaaga
aaaaaagcagccaaagcaatgaagcctgatgccagctctaaagctgctgatgcagcaaag
aagtgtcctccagaagcgcgagcttctgatcagccacagcgccctggcagggcctgggac
tcaatcaaacgccttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagccc
tttaaggctaaactgcaaactgaaatcaatgctgaggatgctaatccttctaagaaaaag
gtaaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cactccaaaatcatagaagactcagaccgcagtgtcaaagtccaagaggctgaaaatctg
gttacaaaaactcagacccaatcagatgaccaggcaacaaagagcaagtcgccccaggat
gtaagggaagatgtctcacagaaaggggacaatgaggtctgtgaatcaaatgtgaacagc
agcataacttctcctggagagaaagtgatttcagtagaacttgagttagatatgggtcat
tctgctattcaaacaggaactctaatccttgaaaatactgaaatgcttgaggaaaaacaa
agcattcaacctcagcacgtgagcccattggaagcttcggacacagaacaggagctccca
gtgggttctgaagttcctccctcacctgcagtcccagatcaacaaattctggaagaagcc
agaaatggtgtcctagacagtggaccagattggaaggagcatgaaagtatagagattgtt
gttgaggagagtaagccaaaagatactgaattgagccaggaattggattttcaagaaaat
gagatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgctatt
attatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccctaag
ccattcttaatttcaattgaaaatgagcaagtaggggtttttgctaatgacagtggtttt
gagggtagaacttcggaacaatatgaaacactcttaatagaaacagcttcttctcttgtc
aagaatgctatccagttgtctatagaacagcttgttaatgaaatggcctctgatgataat
acaataaacaattgtctacagtga

DBGET integrated database retrieval system