KEGG   Bubalus bubalis (water buffalo): 102394789Help
Entry
102394789         CDS       T05912                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform isoform X1
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00071  Fatty acid degradation
bbub01212  Fatty acid metabolism
bbub03320  PPAR signaling pathway
bbub04152  AMPK signaling pathway
bbub04714  Thermogenesis
bbub04920  Adipocytokine signaling pathway
bbub04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102394789 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102394789 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102394789 (CPT1C)
   04920 Adipocytokine signaling pathway
    102394789 (CPT1C)
   03320 PPAR signaling pathway
    102394789 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    102394789 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bbub03029]
    102394789 (CPT1C)
Enzymes [BR:bbub01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102394789 (CPT1C)
Mitochondrial biogenesis [BR:bbub03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102394789 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102394789
NCBI-ProteinID: XP_006080142
Position
18
AA seq 812 aa AA seqDB search
MAEAHQAVGFRPSLTSDAGEVELGAPVLQEIYLSGLRSWKRHLSRFWNDFLTGLFPASPL
SWLFLFSAIQLACFLQLDPSLGLMEKIKESLPDWGGQHHRLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVFSDKDFDWTAGLAQEFLKLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRNSLMVNSNYYMMDFLYVTPTPVQAARAGNAVHALLLYRHRLDRQEILPTLLMGMR
PLCSAQYEKIFNTTRIPGVHRDHIRHLRDSRHVAVFHRGRFFRVETHSQSRLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRDTWAQVRRSLKTQAQEALEAVEGAAFFVSLDSE
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFSLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSADGHCKGHPDPSLPQPQRLHWDLPDKIHLSISLALRAAKTLSGN
IDCHVFPFSHFGKSFIKRCHLSSDSFIQTTLQLAHFRDRGQFCLTYESTMTRLFLEGRTE
TVRSCTREACDFVRAMEDKEKTDAQCLALFRLAVDKHQALLKAAMSGQGVDRHLFALYVV
SQFLHLQSPFLDQVHSEQWQLATSQIPVQQIHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YMFMGDDVITFHISSKKSSTRTVRLTHPGPSSLGTPASLLSYSSGFQTPSLPPTHDPGAP
VLKPRSPQAQGHGPQPSCFSASGNPSPSFSCT
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcaccaggcggtgggcttccgaccctcactgacttcggacgcgggggaa
gtggagctcggtgccccggtgttacaggagatctacctctccggactgcgctcttggaaa
aggcatctctcccgtttctggaacgactttctcacaggcctgttccctgctagccccctc
agctggcttttcctcttcagtgcaattcaacttgcctgcttcctccagctggatccttcc
ttaggactgatggagaagatcaaagagtctctgccagactggggtggacagcatcacagg
ctgcggggggtcctggcggccgcgctgtttgcgtcctgtctgtggggagctctgatcttc
acgcttcatgtggccctgaggctacttctgtcctaccacggctggctcctcgaaccccac
ggagccatgtcctcgccaaccaagacctggctggccctggtgcgcatcttctccggccgc
catccaatgctcttcagttaccagcgctctctgccgcgtcagcctgtgccctccgttcag
gacactgtgcgcaagtatctggagtctgtccgacccgtcttctccgacaaggacttcgac
tggaccgcgggcctagcgcaggaattcctgaagctgcaggcctcactgctgcagtggtac
ttgcagctcaagtcctggtgggcgtccaattacgtcagtgactggtgggaagaattcgtg
tacctgcgctccaggaactcactgatggtgaacagcaactattacatgatggacttcctg
tacgtcacgcccactcctgtgcaggcggcgcgtgcgggcaacgcagtccacgccctcctt
ctgtaccgccaccgcctggaccgccaggagatcctgccaactttgctgatgggaatgcga
cccttgtgctccgcccagtatgagaagatattcaacaccacgcgaattcccggggtccac
agagatcacatccgccacctccgtgacagccgacacgtggccgtcttccaccggggccgg
ttcttccgcgtggagacccactcgcaaagccgcctgctttccccgcgggccctggagcag
cagtttcaacgaatcctggacgacccctctcccgcctgcccccacgaggagcatctggcg
gccttgaccgctgctccgagggacacgtgggcccaggtgcggaggtctctgaagacccag
gcccaagaggccctggaagctgtcgaaggggccgctttcttcgtatccctcgactcagag
cccgcggggctcaccagggaggaccccgcagcttccttagacgcctacgcacacgccctg
ctggccggccggggccacgaccgctggtttgacaaatccttctccctaatcgtcttctcc
aatgggaagctgggcctcagcgtggagcactcatgggctgactgccccatctcaggacac
atgtgggagttcactctggccacagaatgctttcagctgggctactcggcagacggtcac
tgcaaggggcaccctgacccctcgctgccccagccccagaggctgcactgggaccttcca
gacaagatccatctatccatctctctagccctgagggcagccaagaccttgtccggaaac
atcgactgccatgtcttccccttctcccacttcggcaagagtttcatcaaacgctgccat
ctctcttcagacagcttcatccagaccaccttgcagctggcccacttccgggacaggggt
cagttctgcctgacttatgaatccaccatgactcgcttgttcctggaaggccgcacagag
acggtgcgctcttgcacaagggaggcctgcgactttgtgagagccatggaggacaaagag
aagacagacgcacagtgcctcgccctgttccgcctggcggtggataagcaccaagctctg
ctgaaggcagcgatgagtggacagggggtcgatcgccacctctttgctctctacgtcgtg
tcccagttcctccacctgcagtctccattcctggaccaggttcactcagagcagtggcag
ctggccaccagccagattcctgttcagcaaattcacctgttcgacgttcacaattacccc
gactatgtctcatctggtggtggattcgggcctgccgatgaccatggttacggtgtgtcc
tacatgttcatgggcgatgacgtgatcaccttccacatctcgagcaaaaaatcaagcaca
agaacggtgaggctaacccaccccggcccctcctccctcgggactcccgcctccctcctc
tcctacagctcaggattccagactcccagcttgccgcctacccacgatcccggagccccc
gtgctcaaaccccgcagccctcaggcccaggggcacggaccccagccctcttgtttctca
gcctctgggaacccctctcccagcttctcttgcacgtga

DBGET integrated database retrieval system