KEGG   Bubalus bubalis (water buffalo): 102396206
Entry
102396206         CDS       T05912                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub01521  EGFR tyrosine kinase inhibitor resistance
bbub01522  Endocrine resistance
bbub01524  Platinum drug resistance
bbub04010  MAPK signaling pathway
bbub04012  ErbB signaling pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04066  HIF-1 signaling pathway
bbub04068  FoxO signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04114  Oocyte meiosis
bbub04140  Autophagy - animal
bbub04148  Efferocytosis
bbub04150  mTOR signaling pathway
bbub04151  PI3K-Akt signaling pathway
bbub04210  Apoptosis
bbub04218  Cellular senescence
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04270  Vascular smooth muscle contraction
bbub04350  TGF-beta signaling pathway
bbub04360  Axon guidance
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04380  Osteoclast differentiation
bbub04510  Focal adhesion
bbub04520  Adherens junction
bbub04540  Gap junction
bbub04550  Signaling pathways regulating pluripotency of stem cells
bbub04611  Platelet activation
bbub04613  Neutrophil extracellular trap formation
bbub04620  Toll-like receptor signaling pathway
bbub04621  NOD-like receptor signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04650  Natural killer cell mediated cytotoxicity
bbub04657  IL-17 signaling pathway
bbub04658  Th1 and Th2 cell differentiation
bbub04659  Th17 cell differentiation
bbub04660  T cell receptor signaling pathway
bbub04662  B cell receptor signaling pathway
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04668  TNF signaling pathway
bbub04713  Circadian entrainment
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04723  Retrograde endocannabinoid signaling
bbub04724  Glutamatergic synapse
bbub04725  Cholinergic synapse
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04810  Regulation of actin cytoskeleton
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04917  Prolactin signaling pathway
bbub04919  Thyroid hormone signaling pathway
bbub04921  Oxytocin signaling pathway
bbub04926  Relaxin signaling pathway
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04929  GnRH secretion
bbub04930  Type II diabetes mellitus
bbub04933  AGE-RAGE signaling pathway in diabetic complications
bbub04934  Cushing syndrome
bbub04935  Growth hormone synthesis, secretion and action
bbub04960  Aldosterone-regulated sodium reabsorption
bbub05010  Alzheimer disease
bbub05020  Prion disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05034  Alcoholism
bbub05132  Salmonella infection
bbub05133  Pertussis
bbub05135  Yersinia infection
bbub05140  Leishmaniasis
bbub05142  Chagas disease
bbub05145  Toxoplasmosis
bbub05152  Tuberculosis
bbub05160  Hepatitis C
bbub05161  Hepatitis B
bbub05163  Human cytomegalovirus infection
bbub05164  Influenza A
bbub05165  Human papillomavirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05171  Coronavirus disease - COVID-19
bbub05200  Pathways in cancer
bbub05203  Viral carcinogenesis
bbub05205  Proteoglycans in cancer
bbub05206  MicroRNAs in cancer
bbub05207  Chemical carcinogenesis - receptor activation
bbub05208  Chemical carcinogenesis - reactive oxygen species
bbub05210  Colorectal cancer
bbub05211  Renal cell carcinoma
bbub05212  Pancreatic cancer
bbub05213  Endometrial cancer
bbub05214  Glioma
bbub05215  Prostate cancer
bbub05216  Thyroid cancer
bbub05218  Melanoma
bbub05219  Bladder cancer
bbub05220  Chronic myeloid leukemia
bbub05221  Acute myeloid leukemia
bbub05223  Non-small cell lung cancer
bbub05224  Breast cancer
bbub05225  Hepatocellular carcinoma
bbub05226  Gastric cancer
bbub05230  Central carbon metabolism in cancer
bbub05231  Choline metabolism in cancer
bbub05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bbub05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102396206 (MAPK1)
   04012 ErbB signaling pathway
    102396206 (MAPK1)
   04014 Ras signaling pathway
    102396206 (MAPK1)
   04015 Rap1 signaling pathway
    102396206 (MAPK1)
   04350 TGF-beta signaling pathway
    102396206 (MAPK1)
   04370 VEGF signaling pathway
    102396206 (MAPK1)
   04371 Apelin signaling pathway
    102396206 (MAPK1)
   04668 TNF signaling pathway
    102396206 (MAPK1)
   04066 HIF-1 signaling pathway
    102396206 (MAPK1)
   04068 FoxO signaling pathway
    102396206 (MAPK1)
   04072 Phospholipase D signaling pathway
    102396206 (MAPK1)
   04071 Sphingolipid signaling pathway
    102396206 (MAPK1)
   04024 cAMP signaling pathway
    102396206 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102396206 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102396206 (MAPK1)
   04150 mTOR signaling pathway
    102396206 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102396206 (MAPK1)
   04148 Efferocytosis
    102396206 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102396206 (MAPK1)
   04210 Apoptosis
    102396206 (MAPK1)
   04218 Cellular senescence
    102396206 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102396206 (MAPK1)
   04520 Adherens junction
    102396206 (MAPK1)
   04540 Gap junction
    102396206 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102396206 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102396206 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102396206 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102396206 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102396206 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102396206 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102396206 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102396206 (MAPK1)
   04660 T cell receptor signaling pathway
    102396206 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102396206 (MAPK1)
   04659 Th17 cell differentiation
    102396206 (MAPK1)
   04657 IL-17 signaling pathway
    102396206 (MAPK1)
   04662 B cell receptor signaling pathway
    102396206 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102396206 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102396206 (MAPK1)
   04062 Chemokine signaling pathway
    102396206 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102396206 (MAPK1)
   04929 GnRH secretion
    102396206 (MAPK1)
   04912 GnRH signaling pathway
    102396206 (MAPK1)
   04915 Estrogen signaling pathway
    102396206 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102396206 (MAPK1)
   04917 Prolactin signaling pathway
    102396206 (MAPK1)
   04921 Oxytocin signaling pathway
    102396206 (MAPK1)
   04926 Relaxin signaling pathway
    102396206 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102396206 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102396206 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102396206 (MAPK1)
   04916 Melanogenesis
    102396206 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102396206 (MAPK1)
   04270 Vascular smooth muscle contraction
    102396206 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102396206 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102396206 (MAPK1)
   04725 Cholinergic synapse
    102396206 (MAPK1)
   04726 Serotonergic synapse
    102396206 (MAPK1)
   04720 Long-term potentiation
    102396206 (MAPK1)
   04730 Long-term depression
    102396206 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102396206 (MAPK1)
   04722 Neurotrophin signaling pathway
    102396206 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102396206 (MAPK1)
   04380 Osteoclast differentiation
    102396206 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102396206 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102396206 (MAPK1)
   05206 MicroRNAs in cancer
    102396206 (MAPK1)
   05205 Proteoglycans in cancer
    102396206 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    102396206 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102396206 (MAPK1)
   05203 Viral carcinogenesis
    102396206 (MAPK1)
   05230 Central carbon metabolism in cancer
    102396206 (MAPK1)
   05231 Choline metabolism in cancer
    102396206 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102396206 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102396206 (MAPK1)
   05212 Pancreatic cancer
    102396206 (MAPK1)
   05225 Hepatocellular carcinoma
    102396206 (MAPK1)
   05226 Gastric cancer
    102396206 (MAPK1)
   05214 Glioma
    102396206 (MAPK1)
   05216 Thyroid cancer
    102396206 (MAPK1)
   05221 Acute myeloid leukemia
    102396206 (MAPK1)
   05220 Chronic myeloid leukemia
    102396206 (MAPK1)
   05218 Melanoma
    102396206 (MAPK1)
   05211 Renal cell carcinoma
    102396206 (MAPK1)
   05219 Bladder cancer
    102396206 (MAPK1)
   05215 Prostate cancer
    102396206 (MAPK1)
   05213 Endometrial cancer
    102396206 (MAPK1)
   05224 Breast cancer
    102396206 (MAPK1)
   05223 Non-small cell lung cancer
    102396206 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102396206 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102396206 (MAPK1)
   05161 Hepatitis B
    102396206 (MAPK1)
   05160 Hepatitis C
    102396206 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102396206 (MAPK1)
   05164 Influenza A
    102396206 (MAPK1)
   05163 Human cytomegalovirus infection
    102396206 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102396206 (MAPK1)
   05165 Human papillomavirus infection
    102396206 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102396206 (MAPK1)
   05135 Yersinia infection
    102396206 (MAPK1)
   05133 Pertussis
    102396206 (MAPK1)
   05152 Tuberculosis
    102396206 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102396206 (MAPK1)
   05140 Leishmaniasis
    102396206 (MAPK1)
   05142 Chagas disease
    102396206 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102396206 (MAPK1)
   05020 Prion disease
    102396206 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102396206 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102396206 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102396206 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102396206 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102396206 (MAPK1)
   04934 Cushing syndrome
    102396206 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102396206 (MAPK1)
   01524 Platinum drug resistance
    102396206 (MAPK1)
   01522 Endocrine resistance
    102396206 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbub01001]
    102396206 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102396206 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102396206 (MAPK1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102396206 (MAPK1)
Protein kinases [BR:bbub01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102396206 (MAPK1)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102396206 (MAPK1)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102396206 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 102396206
NCBI-ProteinID: XP_025123018
EnsemblRapid: ENSBBUG00015011030
Position
17:complement(857777..914148)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaatctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgacaatgtcaacaaagtccgagtcgccatcaagaaaatcagcccttttgag
caccagacgtactgccagagaacgctgagagagataaagatcttactgcgcttcagacat
gagaacatcatcggaatcaatgacattattcgagcacccaccatcgagcagatgaaagat
gtgtatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaagtatatt
cattcagccaacgtgctgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggaccacgaccac
acagggttcctgacagagtacgtggccactcgctggtaccgggctccagaaatcatgttg
aattccaagggctacaccaagtccatcgacatctggtccgtcggctgcatcctcgccgag
atgctctccaacaggcccatcttccccgggaagcattacctcgaccagctgaaccacatt
ctgggtattcttggatccccgtcgcaggaagacctgaattgtataataaatttaaaagct
agaaactacctgctctctcttccacacaaaaataaggtgccatggaacaggctgttcccg
aacgcggactccaaagctctggatctactggacaaaatgttgacgttcaaccctcacaag
aggattgaggtggagcaggctctggcccatccttacctggagcagtactacgacccgagc
gatgagcccgtcgccgaagcacccttcaagtttgacatggaattggatgacttgcccaag
gaaaagctcaaagaactcatttttgaagagactgctagattccagccgggataccgatct
taa

DBGET integrated database retrieval system