KEGG   Bubalus bubalis (water buffalo): 102396660
Entry
102396660         CDS       T05912                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102396660 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bbub04040]
    102396660 (ASIC1)
Ion channels [BR:bbub04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102396660 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 102396660
NCBI-ProteinID: XP_006075844
Position
4
AA seq 559 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPRQQQQRDSSDSEEEEEEKEKEAERKETREVDSP
MDLVAFANSCTLHGTNHIFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVT
LLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAF
SGEPFNLHHFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRL
KTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAP
GFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctccgtgtcattctcctctggagaggaggcccctgggccc
ttgggagatgtatggggtccccgtcagcagcaacaacgggatagctcagactcagaagag
gaggaagaagagaaggaaaaggaggcagagaggaaggagaccagagaggtggactcaccg
atggacctggtggccttcgccaacagctgtaccctccacggcaccaaccacatcttcgtg
gaggggggtcctgggccgcggcaggccctgtgggcagtggccttcgtcctggcactggga
gccttcctgtgccaggtaggggatcgagttgcctattacctcagctacccacatgtgact
ctgctagacgaagtggccaccacggagctggccttcccggcggtcaccctctgcaacacc
aatgcagtgaggctgtcccaactcagctaccccgacctgctgtacctggcccccatgctg
gggctggacgaaagcgatgacccgggggtgccgctcgcccccccagggcccgaggccttc
tccggggagccctttaacctgcaccacttctacaatcgctcctgtcaccggctggaagac
atgctgctctactgctcctactgcggggggccctgtggccctcacaacttctcggtggtc
ttcacgcggtatggaaagtgctacacgttcaactctggccgagatgggcgcccacggctg
aagaccatgaagggtggaacgggcaacgggctggagatcatgctggacattcagcaggac
gagtacctgcccgtgtggggggaaaccgatgagacgtccttcgaagcaggcatcaaagtg
cagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggcgtagcccca
gggttccagacctttgtggcctgccaagagcagcggctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccatggacttggatttcttcgactcctacagcattaccgcc
tgccgcatcgactgtgagacgcgctacctggtggagaactgtaactgccgcatggtgcac
atgccaggggacgccccatactgcactccagagcagtacaaggagtgtgcagatcctgct
ctggacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccctgcaacctg
actcgctatggcaaggagctgtccatggtcaagatccccagcaaagcatcagccaaatac
ttggccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggac
attttctttgaagtcctcaactatgagaccattgagcagaagaaggcctatgagattgca
gggctcctgggtgacattggaggccaaatggggctgttcatcggggccagcatcctcacg
gtgctggaactctttgactacgcctacgaggtcataaaacacaagctgtgcagaagaggg
aagtgccagaaggaggccaaacggagcagcgcggacaagggcgtggccctcagcctggat
gacgtcaaaagacacaacccgtgcgagagcctccggggccatcctgccgggatgacgtat
gcggccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system