KEGG   Bubalus bubalis (water buffalo): 102398843Help
Entry
102398843         CDS       T05912                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00564  Glycerophospholipid metabolism
bbub00565  Ether lipid metabolism
bbub00590  Arachidonic acid metabolism
bbub00591  Linoleic acid metabolism
bbub00592  alpha-Linolenic acid metabolism
bbub01100  Metabolic pathways
bbub04010  MAPK signaling pathway
bbub04014  Ras signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04217  Necroptosis
bbub04270  Vascular smooth muscle contraction
bbub04370  VEGF signaling pathway
bbub04611  Platelet activation
bbub04664  Fc epsilon RI signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub04724  Glutamatergic synapse
bbub04726  Serotonergic synapse
bbub04730  Long-term depression
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04912  GnRH signaling pathway
bbub04913  Ovarian steroidogenesis
bbub04921  Oxytocin signaling pathway
bbub05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102398843
   00565 Ether lipid metabolism
    102398843
   00590 Arachidonic acid metabolism
    102398843
   00591 Linoleic acid metabolism
    102398843
   00592 alpha-Linolenic acid metabolism
    102398843
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102398843
   04010 MAPK signaling pathway
    102398843
   04370 VEGF signaling pathway
    102398843
   04072 Phospholipase D signaling pathway
    102398843
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102398843
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102398843
   04664 Fc epsilon RI signaling pathway
    102398843
   04666 Fc gamma R-mediated phagocytosis
    102398843
  09152 Endocrine system
   04912 GnRH signaling pathway
    102398843
   04913 Ovarian steroidogenesis
    102398843
   04921 Oxytocin signaling pathway
    102398843
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102398843
  09156 Nervous system
   04724 Glutamatergic synapse
    102398843
   04726 Serotonergic synapse
    102398843
   04730 Long-term depression
    102398843
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102398843
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102398843
Enzymes [BR:bbub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102398843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102398843
NCBI-ProteinID: XP_006066278
Position
11
AA seq 841 aa AA seqDB search
MKRPWRRCHGSPWTLWLQIWPGTPVTARPRRFAAQCGRVRCSTCRPCGSTTSSSPMAALL
AKVPGTCLLTIRVLQAHGLPSKDLVTSSDCYVTLWLPTASSHQLQTRTVKNCRNPVWNQS
FHFRIHSQIKNIVYLRVFDQDLLTTDDPMLSVLFDVGTLRAGESRRESFSLSPQGEERLE
VEFRLQNLTDGAECLFSNGILVARELSCLHVRLEKAGDLQESESRVQLVVPGSCEGPQEA
FVGAGSFHFHWPACWEQELSIHLQDAPQEQLKVPLRALPSGQVVRLVFPTSQEPLMKVEL
KNEEGPRDLAVRLGCGPCAEEQAFLSRRKQVVAKALQQALQLDRDLREDEIPVVAVMATG
GGIRAMTSLYGQLAGLKALGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPIESLK
TQVTKSKLGVLAPRQLLRYQQELAERARLGHPACFTNLWALINEALLHDEPHDHKLSDQR
EALSRGQNPLPIYCALNTKEQNLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEFFMG
RLTKQLPESRICFLEGIWSNLYAANLQDSLYWSSEPSQFWDRWAQARASLDKEQVPLLKI
EEPPTVAGRIAEVFTDLLTRRPLAQATHNFLRGFSFHKDYFQHPHFSAWKATKLDGLPNE
LTPAEPYLCLLDVGYLVNTSCPPLLPPTRDVDLILSLDYNLHGAFQQLQLLGRFCQEQGI
LFPPISPSPEEQCQPQECHLFSDPTRPDIPAVLHFPLVNASFRDHSAPGVRRTAEEQAAG
EVNLSASDSPYHYSKVTYSLEDMDKLLHLTQYNICNNQERLLEALREAMQRRRQRTQRRP
E
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggccatggagaaggtgccatggatccccctggaccctttggctccagatctgg
cccggtaccccagttactgccaggcccaggcgcttcgctgcacagtgcgggcgggtgaga
tgctctacctgccggccctgtggttccaccacgtccagcagtcccatggctgcattgctg
gcaaaggtgcctgggacctgcttactcaccattcgtgtcctgcaggcccatggcctgccc
tccaaggacctcgtgacctcctctgactgctacgtgaccctgtggctgcccacggcctcc
agccaccagctgcagacgcgcacagtcaagaactgcagaaaccccgtctggaatcagagc
tttcacttccgaatccatagccagatcaagaacatcgtgtatcttagagtctttgaccag
gaccttctgaccacggatgaccccatgttgtcagtgctatttgacgtggggaccttgcgg
gctggggagtcccggcgcgagagcttctcgctgagccctcagggtgaggaacgcctggaa
gttgaatttcggctgcagaatctgactgatggtgctgagtgcctcttcagcaatggcatc
ctagtggcccgggagctctcctgcttgcatgttcgactggagaaggcaggggacctgcag
gagtcggagagtagagttcagcttgtggttcccgggtcctgtgagggtccacaggaggcc
ttcgtgggcgccggctccttccacttccattggccagcctgctgggagcaggagctgagt
attcacctgcaggatgccccccaagagcagctgaaggtgcccctgagggctctgccctct
ggccaagtggtgcgactcgtcttccctacatcccaggagcccttgatgaaagtggagctg
aaaaatgaagaaggacccagggacctggctgtgcggctgggctgcgggccctgtgctgag
gagcaggcgttcctgagcaggaggaagcaggtggtggccaaggccctgcagcaggccctg
cagctggacagagacctgcgggaagatgagatcccagtggttgctgttatggccactggt
ggtggcatccgggccatgacctcactgtatgggcagctggctggcctaaaggcgcttggc
ctcttggattgtgtctcctacatcacgggggcctcgggctccacctgggctttggccaac
ctctacgaggatccagagtggtctcagaaggatctggctgggcccatcgagtcactgaag
acccaggtgaccaagagcaagctgggtgtgctagcccccaggcagctactgcggtaccag
caggagctggctgagcgcgcccgcctgggccacccggcctgcttcaccaacctgtgggcc
ctcatcaacgaggcgctactacatgacgagcctcatgaccacaagctctcagaccagcgg
gaggccctgagtcgaggccagaaccccctgcccatctactgtgctctcaacaccaaggaa
cagaatctgaccacctttgaatttggggagtggtgtgagttctccccctacgaggtcggc
tttcccaagtacggtgccttcatcccctccgagctcttcggctctgagttcttcatgggg
cgcctgacaaaacagcttcctgagtcccgcatctgcttcctggaaggtatctggagcaac
ctgtatgcagccaacctccaggacagcctatactggtcatccgagcccagccagttctgg
gaccgctgggcacaagctcgggccagcctggacaaggagcaggtcccccttctgaagata
gaagagcctcccacggtggccggcaggatagcggaggttttcaccgaccttctgacgcgg
cgtccacttgcccaggccacccacaatttcctacgtggcttctccttccacaaggactat
ttccagcatcctcacttttctgcctggaaagctaccaaactggacggcctccccaacgag
ctgacacctgcagagccctacctttgcttgctggatgttgggtaccttgtcaataccagc
tgcccacccctcctgccgcccacacgggatgtggacctcatcctgtcgctagattacaat
ctccatggagccttccagcagctgcagcttctgggtcggttctgccaggagcagggcatc
ctgttcccgcccatctcgcccagccctgaggagcagtgccagccccaagagtgccacctc
ttctcggaccccacccgccctgacatccctgccgtgctgcacttccctctggtcaacgcc
tccttcagggaccactctgcccccggggtccggcggacagccgaggagcaggcggctggg
gaggtgaacctgtctgcatccgactccccctaccactactcgaaggtgacctacagcctg
gaggacatggacaagctgctccacctgacgcagtacaacatttgcaacaaccaggagcgg
ctgctggaggccctgcgtgaggccatgcagaggcggaggcagcgcacgcagcgccggcct
gagtga

DBGET integrated database retrieval system