KEGG   Bubalus bubalis (water buffalo): 102400188Help
Entry
102400188         CDS       T05912                                 

Gene name
PHF6
Definition
(RefSeq) PHD finger protein 6 isoform X1
  KO
K23310  PHD finger protein 6
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bbub03000]
    102400188 (PHF6)
   03009 Ribosome biogenesis [BR:bbub03009]
    102400188 (PHF6)
   03036 Chromosome and associated proteins [BR:bbub03036]
    102400188 (PHF6)
Transcription factors [BR:bbub03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    102400188 (PHF6)
Ribosome biogenesis [BR:bbub03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   102400188 (PHF6)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    102400188 (PHF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 102400188
NCBI-ProteinID: XP_006074865
Position
X
AA seq 366 aa AA seqDB search
MSSSVEQKKGPTRQRKCGFCKSNRDKECGQLLISENQKVAAHHKCMLFSSALVSSHSDNE
SLGGFSIEDVQKEIKRGTKLMCSLCHCPGATIGCDVKTCHRTYHYHCALHDKAQIREKPS
QGIYMVYCRKHKKTAHNSEAADLEESFNEHELEPSSPKSKKKSRKGRPRKTNFKGLSEDT
RSTSSHGTDEMESSSYRDRSPHRSSPSDTRPKCGFCHVGEEENQARGKLHIFNAKKAAAH
YKCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACVK
TYHYHCGVQDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKVEIDQQQLTQ
QQLNGN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctctgttgaacagaaaaaagggcctacaagacagcgcaaatgtggcttttgt
aagtcaaatagagacaaggaatgtggacagttactaatatctgaaaaccagaaggtggca
gcacaccataagtgtatgctgttctcatctgctttggtttcatcacactctgataacgaa
agtcttggtggattttctattgaagatgtccaaaaggaaattaaaagaggcacgaagctg
atgtgctctttgtgccattgtcccggagcaacaattggttgtgatgtgaagacttgtcac
aggacataccactaccactgtgcgttgcatgacaaagctcaaatacgagagaaaccttca
caagggatatacatggtttattgtcgaaaacacaagaaaactgcacataattctgaagca
gctgatttagaagaaagttttaatgaacatgaactggagccttcatcgcctaaaagtaaa
aagaaaagtcgcaaaggaaggccacgaaaaactaattttaaaggactgtcggaagatacc
aggtctacatcctctcatggaacggatgaaatggaaagtagttcctatagagatcggtct
ccacatagaagcagccctagtgacaccaggcctaaatgtggattttgtcatgtaggggag
gaagaaaatcaagcaagaggaaaactgcatatatttaatgccaagaaggcagctgcacat
tataaatgcatgttattttcttctggcaccgtgcaactcacaacaacttcaagagcagaa
tttggagattttgatattaaaactgtactgcaggagattaaacgagggaaaagaatgaaa
tgtacactttgcagtcagcccggtgctactattggatgtgaaataaaagcctgtgttaag
acttaccattaccactgtggagtacaagacaaagctaaatacattgaaaatatgtcacga
ggaatttacaaactatattgtaaaaatcatagtggaaatgatgagagagatgaagaagat
gaagaacgagagagtaaaagccgaggaaaagtagaaattgatcagcaacaactaactcag
cagcagcttaatggaaactag

DBGET integrated database retrieval system