KEGG   Bubalus bubalis (water buffalo): 102400426Help
Entry
102400426         CDS       T05912                                 

Gene name
HDC
Definition
(RefSeq) histidine decarboxylase isoform X1
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00340  Histidine metabolism
bbub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102400426 (HDC)
Enzymes [BR:bbub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     102400426 (HDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102400426
NCBI-ProteinID: XP_006077856
Position
11
AA seq 658 aa AA seqDB search
MMEPEEYRERGKEMVDYICQYLTTVRERRVTPDVRPGYLRAQLPESAPMEPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPGSQGGGVLQSTVSESTLIALLAARKNKILEMKASEPEADESF
LNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDENFSLRGEALQKAIKEDRERGLVPIF
VCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVDPVYLRHADSGVATDFMHWQIPLSRRFRSI
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPFFEIPAKRHLGLVVFRLKGPNCLT
ESVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIQDAATLILSQHCT
SQPSPQGANLILQTRGPRTLAKEMSFPSVNGAGDDPAHSRKIVKQPPRVGASPVSRHLET
LLDPLDDCFSEEAPDVTEHKLSSFLFSYLSVQNKRKAVRSLSCNSVPVSAQKQLTTEGSV
KNGSSSRVRIFSRFPEEVMMLKKSAFKKLIKFYSVPNFPECSSQCGLQLPCCPLQAMV
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcctgaagaatacagagagagaggaaaggagatggtggactacatctgccag
tacctgaccactgtgcgggagcggcgggtgactccggacgtgaggcccggctacctgcga
gcccagctgcctgagagtgcgcccatggagcccgacagctgggacagcatctttggggac
attgagcgaatcatcatgcctggggtggtgcactggcagagcccccatatgcatgcctac
tacccagctctcacctcttggccatcgctgctgggagacatgctggctgatgccatcaac
tgcttgggattcacctgggcttccagtcctgcgtgcacggagctggagatgaacgtcatg
gactggctggcaaaaatgctgggactcccggagcacttcctgcaccaccaccccggcagc
caggggggaggcgtcttgcagagcacagtcagcgagtccaccttgatcgccttgctggca
gcaaggaagaacaaaatcctggaaatgaaagcctctgagcctgaggcagacgagtccttc
ctgaacgcccggcttgtggcctatgcctccgaccaggcccactcctcggtggaaaaggct
ggtctgatttccctggtcaagatgaaatttctgcctgtggatgagaacttctcgctccga
ggggaagctcttcagaaagccatcaaggaggacagggaaaggggcctggtgcccatcttt
gtctgtgcaacgctggggaccactggggtctgtgcatttgactgcctgtcagagctgggc
cccatctgtgcccgtgaggggctgtggctccacattgacgctgcctacgcaggcactgcc
ttcctgtgccccgagttccggggctttctgaagggcatcgaatatgccgattccttcacc
tttaacccttccaagtggatgatggtgcactttgactgcaccggcttctgggtcaaggac
aagtacaagctgcagcagaccttcagcgtagaccctgtctacctcaggcacgctgactcg
ggcgtggccaccgacttcatgcactggcagatccccttgagccgacgctttcgctctatt
aaactctggttcgtgattcggtcctttggggtgaagaatcttcaagcgcatgtcagacat
ggcactgaaatggctaagtattttgaatctctggtcagaaatgaccctttctttgaaatt
cctgccaagaggcaccttggcctggtggtttttcgtctcaagggtcctaactgcctcaca
gaaagcgtgttaaaggaaatagctaaagccggccgtctcttcctcattccagccactatc
caggacaagttgatcatccgtttcactgtgacatcccagttcaccaccagggatgacatc
ctgagagactggaatctcattcaggatgctgccactctcatcctgagtcagcattgtact
tcccaacccagccctcagggggcgaacctcatcctccaaaccaggggccccagaaccttg
gccaaggagatgtcctttccctctgtcaacggggcaggcgatgacccagcccattccagg
aagatcgtcaagcagcctccacgtgtgggagccagtcctgtgagccggcatcttgaaacc
ctgctggacccactggatgactgcttctctgaagaggctccagacgtcaccgagcacaag
ctgtcctccttcctgttcagttatttgtctgtgcagaacaagaggaaggcagtacgttcc
ctcagttgcaatagcgtgcctgtgagtgctcaaaagcaactgaccacagaaggctctgtg
aagaatggcagctcctcccgggtcagaatcttttctaggttcccagaagaggtgatgatg
ctgaagaagagtgccttcaaaaaactaatcaagttctacagtgtccccaactttcctgaa
tgcagctctcagtgtgggctacagctgccctgctgccctctgcaggcaatggtttag

DBGET integrated database retrieval system