KEGG   Bubalus bubalis (water buffalo): 102401218Help
Entry
102401218         CDS       T05912                                 

Gene name
GPX3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00480  Glutathione metabolism
bbub00590  Arachidonic acid metabolism
bbub01100  Metabolic pathways
bbub04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102401218 (GPX3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102401218 (GPX3)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102401218 (GPX3)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102401218 (GPX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102401218
NCBI-ProteinID: XP_025148181
Position
9
AA seq 226 aa AA seqDB search
MARLFRASCLLSLLLAGFIPPSQGQEKSKTDCHAGVGGTIYEYGALTIDGEEYIPFKQYA
GKYILFVNVASYUGLTGQYVELNALQEELEPFGLVILGFPCNQFGKQEPGENSEILATLK
YVRPGGGFTPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWYHRTTVNSVKMDILTYMRRRAVWEAKGK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctcttccgggcatcctgtcttctctccctgctcctggccggcttcattccc
ccgagccagggacaggagaagtcgaagacggactgccacgctggtgtgggtggcaccatc
tatgagtacggggccctcaccatcgatggggaggagtacatcccctttaagcagtacgct
ggcaaatacatcctcttcgtcaacgtggccagctactgaggcctgacgggccagtacgtt
gaactgaatgcactgcaggaagagctcgaaccatttggtctggtcattctgggcttcccc
tgcaaccaatttggaaaacaagaaccaggagagaactcggagatcctagccaccctcaag
tatgttcgaccaggtgggggcttcacccccaatttccaactgtttgagaaaggcgatgtg
aatggggagaaagagcagaagttctacactttcctgaagaactcctgtcctcctacctca
gagctcctaggctcacctgaccgccttttctgggaacccatgaaggtccatgacatccgg
tggaactttgagaagttcctggtggggccagacggcatccccatcatgcgctggtaccac
cgcaccacggtcaactctgtcaagatggacatcctgacctacatgcggcggcgggcggtc
tgggaggccaaggggaagtaa

DBGET integrated database retrieval system