KEGG   Bubalus bubalis (water buffalo): 102403282
Entry
102403282         CDS       T05912                                 

Gene name
ANKRD53
Definition
(RefSeq) LOW QUALITY PROTEIN: ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102403282 (ANKRD53)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102403282 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Other DBs
NCBI-GeneID: 102403282
NCBI-ProteinID: XP_006066714
Position
12
AA seq 537 aa
MPSLQDAWAVGWGNQLVGDPAREARSSRPSTTTLVRECLPASARSASWHFARWAEAAPIR
RRYLSGDVHLQLAKKGSTTRKESAVRRRSSMSLAEEWDQRAMGGSYYELFAASLGNLEWL
RFCLNRHRGEILADDKGFTAIHFAAQSGKLACLQVLVEEYKFPVNLPTNNGQTPLHLVIH
GDNKTMALACIHYLIKQGAALNTQTCNGSTPLHLAAREGLLSCVKVLVQKGANVHAQDAT
GCKPIDYCKIWNHRVCARFLKDAMWKRDKKDFAHEMRKLKRLKDQLALMEEDYLTEYQKE
HQILREADFKKWLHHKLLLQDQSLIPSVQREPRALPRAAALSKTCKDGVLWPPSSFHPSP
EARLQQIQQPNLPLVMSAPTYKPPTIRRPKVWNLSSNPARSPTAQIGYPQGVRLGVHPDP
RPERDFRCFVEVRSDGHGGAHLRTVAGSQVAPVPRLPFEVVIRELYPLVRPYRMKVPQDF
CSVAMEEVPRKRHLGDSSFWTDTLSMNLRETFDEAFLAAVRAHQGLPALPSPKPPLP
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgccgagtctccaggacgcgtgggccgtggggtggggtaaccaactggtcggtgacccg
gccagggaggcgcgaagttcccgcccctccaccacgaccctagtccgggagtgcctgccg
gcctccgcccgtagcgccagctggcacttcgccaggtgggcggaggcggcacccatcagg
cggcggtacctctccggggacgtacacctgcaactagcaaagaagggctcaaccacccgc
aaagagtcggcggtccggcggcgcagttccatgagtctagccgaggagtgggaccagaga
gcgatgggaggaagctactacgaactgttcgcggcctcattgggcaacctggaatggttg
cggttctgtttaaaccggcatcgtggcgaaatcctggccgatgacaagggtttcactgcc
atccactttgcagcccagagcggcaagcttgcatgcctgcaggtcttggtggaggaatac
aagtttcccgtaaacctgcccaccaacaatggccagacacctctgcaccttgtcatccat
ggtgacaacaagaccatggccctcgcctgcattcactatctgattaagcaaggggcagcc
ctcaacactcagacgtgcaatggctccacacctctgcatctggcagcccgcgaaggcctg
ctgagctgtgtcaaagtcctggtgcagaaaggtgccaatgtccacgcacaagatgccaca
ggctgcaagcccattgactactgcaaaatatggaaccaccgagtctgtgcccggttcctg
aaagatgccatgtggaaacgggacaagaaggactttgcccatgagatgaggaaactgaag
aggctcaaggaccagctggccctcatggaggaggactacctgactgagtatcaaaaggag
caccaaattctgagagaagctgacttcaagaagtggctccatcacaagttgctactccaa
gaccagtccctaatacccagcgttcagcgagagccccgtgctctgccccgggccgctgcc
ctctccaagacctgcaaggacggggtactgtggcctccctcgagcttccacccctccccg
gaggcacgcctgcaacagatacagcagcccaatctgcccttggtgatgtctgcgcccacc
tacaagccgcccacgatcaggcggcccaaggtgtggaatcttagcagcaatcccgccagg
tcccccaccgcccagatcggctacccacagggcgtccgcctgggcgtgcatcccgacccc
aggccagagcgcgacttccgctgcttcgtggaggtgaggtccgacgggcacggtggcgcg
cacctgcgcacggtggccggcagccaggtggcgcctgtgccccggctgcctttcgaagtg
gtaatccgcgagctgtaccctttggtgcggccctacagaatgaaggtgccccaggacttc
tgctctgtcgctatggaagaggtgccccggaagcggcacttgggtgacagcagcttctgg
accgacacgctgagcatgaacctgcgagagacattcgacgaggccttcctggcggctgtg
cgagcccatcaaggactccccgctctgccttcccctaaaccacccctcccttaa

DBGET integrated database retrieval system