KEGG   Bubalus bubalis (water buffalo): 102404885
Entry
102404885         CDS       T05912                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00230  Purine metabolism
bbub00240  Pyrimidine metabolism
bbub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102404885 (DCK)
   00240 Pyrimidine metabolism
    102404885 (DCK)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102404885 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 DUF932 CoaE
Other DBs
NCBI-GeneID: 102404885
NCBI-ProteinID: XP_006069401
Position
7
AA seq 260 aa
MATPPKRSCPSPAASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLIEKVKDFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccactccacccaagaggagctgcccgtctcccgcagccagctctgaggggacccgc
atcaagaaaatttccatcgaagggaacatcgctgctgggaagtcaacatttgtgaatatc
cttaaacaagtctgtgaggactgggaagtggtgcctgaacctgttgcccggtggtgcaat
gttcagagtactcaggatgaatttgaggaactgacaacatctcagaaaagtggcgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccagtcatatgcc
tgcctcagtcgaatacgagctcagcttgccgctctcaatgggaaactcaaagatgcagag
aaaccagtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttagagcc
actccagagaaatgcttgaatagaatatatttaaggggaagaaatgaagaacaaggcatt
cctcttgaatacttggagaaacttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgacagcctaattgaaaaggtaaaagactttttgagcactttg
tga

DBGET integrated database retrieval system