KEGG   Bubalus bubalis (water buffalo): 102405051Help
Entry
102405051         CDS       T05912                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00350  Tyrosine metabolism
bbub00360  Phenylalanine metabolism
bbub00380  Tryptophan metabolism
bbub01100  Metabolic pathways
bbub04726  Serotonergic synapse
bbub04728  Dopaminergic synapse
bbub05030  Cocaine addiction
bbub05031  Amphetamine addiction
bbub05034  Alcoholism
Module
bbub_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
bbub_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102405051 (DDC)
   00360 Phenylalanine metabolism
    102405051 (DDC)
   00380 Tryptophan metabolism
    102405051 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102405051 (DDC)
   04726 Serotonergic synapse
    102405051 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    102405051 (DDC)
   05031 Amphetamine addiction
    102405051 (DDC)
   05034 Alcoholism
    102405051 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102405051 (DDC)
Enzymes [BR:bbub01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     102405051 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     102405051 (DDC)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102405051 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102405051
NCBI-ProteinID: XP_006073569
Position
8
AA seq 487 aa AA seqDB search
MNASEFRRRGKEMVDYVADYLEGIEGRQVFPDVDPGYLRPLIPTTAPQEPETFEAIIEDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMVQLPEAFLAGEAGEGGGVIQGTASEATLVALLAARTKVTRRLQAASPELTQAAIM
EKLVAYASDQAHSSVEKAGLIGGVRLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVV
ATLGTTACCSFDNLLEVGPICHEEGLWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPVYLRHSHQDSGLITDYRHWQLPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHAFEALVRQDTRFEICAEVILGLVCFRLKGSNKLN
EALLESINSAKKIHLVPCSLRDRFVLRFAICSRTVELAHVQLAWEHIQEMAAMVLKAQGE
EKEEIKN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaagcgagttccgcaggcgggggaaggaaatggtggattacgtggctgactac
ctggagggcatcgaggggcgccaggtgttccctgacgtggatccaggctacctgcgcccc
ctgatccccaccactgccccgcaggagccagagacatttgaggccatcatcgaggacgtc
gagaagatcatcatgccgggggtgacccactggcacagtccctacttcttcgcctacttc
cccacggccagctcgtacccggccatgctcgcggacatgctgtgtggggccatcggctgc
atcggcttctcctgggctgccagcccagcgtgcacagagctcgagacagtgatgatggac
tggctggggaagatggtgcagctgccagaggcgtttctggctggagaagctggagaaggc
ggcggggtgatccagggaactgccagtgaagctaccctggtggccctgctggccgctcgg
accaaagtgacccgacgcctgcaggctgcctccccggagctgacgcaggctgccatcatg
gagaagttggtggcctacgcgtctgaccaggcacattcctccgtggaaaaagccggctta
attggcggagtgagattaaaagccatcccttctgatggcaagtttgccatgcgagcttcc
gcgctgcaggaggccctggagagagacaaggcagccggcctgattcctttcttcgtggtg
gctacactggggaccacggcctgctgctcctttgacaacctcttagaagtggggcccatt
tgtcacgaggagggcttgtggctgcacgtggatgccgcctacgcgggcagcgccttcatc
tgccctgagttccggcatcttctgaatggcgtggagtttgcagattcatttaactttaat
ccccacaaatggctcttggtgaattttgactgctctgccatgtgggtgaaaaagaggaca
gacctgaccggagccttcaggctggatccggtctacctgaggcacagccaccaggactca
gggcttatcactgactacaggcactggcagctgccgctgggccggaggttccgctctttg
aagatgtggtttgtttttaggatgtacggagtcaagggactgcaggcctatatccgcaag
cacgtccagctgtcccatgcatttgaggcattggtgcgccaggacacccgctttgaaatc
tgtgcagaagtcattctgggactggtctgtttccggctaaagggttccaacaaactgaac
gaagctcttctggaaagcataaacagtgccaaaaaaatccacttggtcccttgttccctg
agagaccggttcgtgctgcgctttgccatctgctcacgcacagtggagctggcccacgtg
cagctggcctgggagcacatccaggagatggcggccatggtgttaaaagcacagggggag
gaaaaggaagagatcaaaaattga

DBGET integrated database retrieval system