KEGG   Bubalus bubalis (water buffalo): 102405059
Entry
102405059         CDS       T05912                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102405059 (RDH5)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     102405059 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10
Other DBs
NCBI-GeneID: 102405059
NCBI-ProteinID: XP_006075150
Position
4
AA seq 318 aa
MWLPLLLGVLLWAALWLLRDRQCLPASDACIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSIRQAVKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWQTREDFQRVLNVNTLGPIGVTLALLPLLLQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTHVTNLETLEDTLQACWARLPPATQALYGEA
FLTKYLRVQQRIMNMICDPDLAKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQMVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggtgtcttgctctgggcagcgctgtggttgctcagggac
cggcagtgcctgccagccagcgatgcttgtatcttcatcaccggctgtgactcgggcttt
gggcggctccttgctctgaggctggaccagagaggcttccgagtactggccagctgcctg
acaccctcgggggcagaggacctccagcgggtcgcctcctcccgcctccacaccaccctg
ctggatgtcacagatccccagagcatccggcaggcagtcaagtgggtggaaacgcatgtt
ggggaagcagggctttttggtctggtgaataatgctggtgtggctggcatcattggtccc
accccatggcagacgcgggaggacttccagcgggtgctgaatgtgaacacgctgggtccc
atcggggtcaccctcgccctgctgcccctgctgctgcaggcccggggccgagtgatcaac
atcaccagtgtccttggccgcctggcagccaatggagggggctactgcgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgagacgtggctccttttggggtacgggtc
tctatcgtggaacctggcttcttccgaacccatgtgacaaacctggaaactttggaggac
accctgcaggcctgctgggcacggctgcctccagccacacaggccctctatggggaggcc
ttcctcaccaaatacctgagagtgcagcaacgtatcatgaacatgatctgtgacccggac
ctggccaaggtgagcaggtgcctggagcatgccctaactgcccgtcaccccagaacccgc
tacagcccaggctgggatgccaagctgctctggttgccagcctcctacttgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcctgcccagatggtctactaa

DBGET integrated database retrieval system