KEGG   Bubalus bubalis (water buffalo): 102406406Help
Entry
102406406         CDS       T05912                                 

Gene name
KDM4B
Definition
(RefSeq) LOW QUALITY PROTEIN: lysine-specific demethylase 4B
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbub03036]
    102406406 (KDM4B)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     102406406 (KDM4B)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     102406406 (KDM4B)
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    102406406 (KDM4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC zf-HC5HC2H_2 Tudor_2 zf-HC5HC2H JmjN PHD_2 LBR_tudor PHD Tudor_3 DUF4537
Motif
Other DBs
NCBI-GeneID: 102406406
NCBI-ProteinID: XP_025149045
Position
9
AA seq 1116 aa AA seqDB search
MGSEDHGAQNPSCKIMTFRPTMEEFKDFNKYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGNLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYELWKQGKDLTVLDHTRPTALSSPELSTWSA
SRASLKAKLLRRQISLKENRHWKKTEEERKPSLERKREQTRRPGLSSHRKRSQPKKPKPD
DPRSPGEGAAGAALLEEAGGSTKEEAAPEADPEEEEEEAQLLPQGREAEGSEEDGRGKLQ
LAKAKSDRKKKSYGSPHPHHPLLPPPPSAQFTEEAPLLEIPGPAPGLEAAEKSPLPPPLN
VVPPKAPGEEPEAKPRPVIPMLYVVPRPGPTGNKGRVSCQQASEHFAQKGPTWKEQATPM
ELTGPEEESRASEGQNPSTFSKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEESFPF
SGDEDVGDPEALRSLLALQWKNKASNFQAERKFNAAAALTEPYCAICTLFYPYSQSLQTE
KEAPQAALGEGSSAIPPSRSGQKTRPLIPEMCFTASGENTEPLPANSYIGDDGTSPLIAC
AKCCLQVHASCYGIRPELVNEGWTCSRCTAHAWTAECCLCNLRGGALQMTTDRRWVHVIC
AIAVPEVRFLNMMERHPVDISGIPEQRWKLKCVYCRKRMKKVSGACVQCSCEHCSTSFHV
TCAHAAGVLMEPDDWPYVVSITCFKHKSGGHNVQVMRAVSLGQVVITKNRNGLYYRCRVI
GTTTQTFYEVNFDDGSYSDNLYPESITSRDCARLGPPPEGEFVELRWTDGNLYRAKFISS
VTSHIYQVEFEDGSQLTVKRGDIFTLDEELPKRVRSRLSVSTGAPQESVFSGEEVKAAKR
PRVGTPRAAEDSGRNPDYPAFVESLLQAQCWPGAPY
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggggtctgaggaccatggggcccagaacccaagctgtaagatcatgacgttccgccca
accatggaggaattcaaggacttcaacaaatatgtggcctacatcgagtcccagggggcc
caccgggcgggcctggccaagatcatccccccaaaggagtggaagccgcggcagacatat
gatgacatcgatgacgtggtcatcccagcgcccatccagcaggtggtgacgggccagtcg
ggcctcttcacacagtacaacatccagaagaaggccatgacggtcggcgagtaccggcgc
ctggccaacagcgagaagtactgcacgccccggcaccaggactttgatgacctggagcgc
aagtactggaagaacctgacgttcgtgtcacccatctacggggccgacatcagtggctcc
ttgtacgatgacgacgtggcccagtggaacatcgggaacctgcggaccatcctggacatg
gtggagcgtgagtgcggcaccatcatcgagggcgttaacaccccctacctgtacttcggc
atgtggaagaccaccttcgcctggcacacggaggacatggatctgtacagcatcaactac
ctgcacttcggggagcccaagtcctggtatgccattcccccggagcatggcaagcgcctg
gagcggctggccatcggcttcttccccggaagctcccagggctgcgatgccttccttcgg
cacaagatgactctcatctcgcccattatcctcaagaagtatgggatcccgttcagccgg
atcacacaggaggcaggggagttcatgatcacgttcccctacggctaccatgctggcttc
aaccacggattcaactgcgccgagtccaccaattttgccacactgcggtggatcgattac
ggcaaggtggccacccagtgcacgtgccggaaggacatggtcaagatctccatggacgtc
ttcgtgcgcatcctgcagccggagcgctacgagctgtggaagcagggcaaagacctgact
gtgctggaccacacgcggcccacggccctgagcagccccgagctgagtacctggagcgcc
tcccgggcctcgctcaaggccaagctcctgcgcagacaaattagtctgaaggaaaacaga
cactggaaaaagactgaggaggagagaaaacccagtctagagaggaagagagagcagacc
aggaggccggggctctcgtctcaccggaaacggagccagcccaagaagcccaagcccgac
gaccccaggtctcctggagagggggcagccggggcagccctcctggaggaggcaggaggc
agcacgaaagaggaggcagcacctgaggctgacccagaggaggaggaagaggaagcccag
ctgctgccacagggccgggaggccgagggctcagaagaggacgggaggggcaagctgcag
ctggccaaggccaagagtgaccggaagaagaagagctacggctccccacacccccaccac
ccgctgctgccaccgcccccgtccgctcagttcaccgaggaggcgcccttgctggagatc
ccaggacccgcccccggccttgaggctgctgagaagagccccctgccaccacccctcaat
gtggtgccccccaaggcccccggcgaggagccagaggcaaagccacgccctgtcatcccc
atgctgtacgtggtacctcggcccggccctaccggcaacaagggccgcgtgtcctgccag
caggcctcggagcactttgcccagaaaggccccacctggaaggagcaggccacccccatg
gagctgacggggcccgaggaggagagcagagctagtgaggggcagaatccgtccaccttt
tccaagttgaaaatggagatcaagaagagccggcgccaccctctgggcagaccgcccacc
cggtccccgctgtccgtggtcaagcaggaggcctcgagtgacgaggaatccttccctttc
tccggggacgaggacgtgggtgaccctgaggccttgaggtcattgctggccctgcagtgg
aagaacaaagcgtccaacttccaggccgagaggaagttcaacgcggcagctgctctgaca
gagccctactgcgccatctgcactcttttctacccgtacagtcagtccctgcagactgag
aaggaggctccccaggctgccctcggggagggctcctcggccatcccaccttccagaagc
ggccagaagacgcggccgctgatccctgagatgtgtttcacggccagcggggagaacacg
gagccgctccccgccaactcctacattggcgacgacgggaccagcccgctgatcgcctgc
gccaagtgctgcctgcaggtccatgccagttgctacggcatccgcccggagctggtcaac
gagggctggacgtgttcccggtgcacggcccacgcctggactgcggagtgctgcctgtgc
aacctccggggaggcgccctgcagatgacaaccgaccggaggtgggtccacgtgatctgc
gccatcgccgtgccggaagtgcggttcctgaacatgatggagcgtcaccccgtggacatt
agcggcattcccgagcagcggtggaagctgaaatgtgtgtactgccggaaacggatgaag
aaagtgtcgggcgcctgcgtccagtgctcctgcgagcactgctccacctccttccacgtg
acctgcgcccacgccgccggcgtcctcatggagccagacgactggccctacgtcgtctcc
atcacctgcttcaagcacaagtcggggggccacaatgtccaggtcatgagggccgtgtcc
ttgggccaggtggtcatcaccaagaaccgcaacgggctttactaccggtgccgcgtcatc
ggcaccaccacgcagaccttctatgaagtgaactttgatgacggatcctacagcgacaac
ctgtatccagagagcatcactagtagagactgtgcccggttgggcccaccacccgagggc
gagttcgtggagctccggtggactgacggcaacctctacagggccaaattcatttcctct
gtgaccagtcacatctaccaggtggagttcgaggatgggtcccagctgacggtgaagcgt
ggtgacatcttcaccctggatgaggagctccccaagagggtccggtcccggctgtcggtc
agcacaggggccccacaggagagcgtcttctccggagaggaggtgaaggccgccaagcgc
cctcgggtgggcacccctcgcgccgcagaggactcagggcggaacccggactacccggcc
ttcgtggagagcctgctgcaggcgcagtgctggcccggagccccctactag

DBGET integrated database retrieval system