KEGG   Bubalus bubalis (water buffalo): 102408103
Entry
102408103         CDS       T05912                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X2
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00230  Purine metabolism
bbub01100  Metabolic pathways
bbub01522  Endocrine resistance
bbub04015  Rap1 signaling pathway
bbub04020  Calcium signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04062  Chemokine signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04114  Oocyte meiosis
bbub04211  Longevity regulating pathway
bbub04213  Longevity regulating pathway - multiple species
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04270  Vascular smooth muscle contraction
bbub04371  Apelin signaling pathway
bbub04540  Gap junction
bbub04611  Platelet activation
bbub04713  Circadian entrainment
bbub04714  Thermogenesis
bbub04723  Retrograde endocannabinoid signaling
bbub04724  Glutamatergic synapse
bbub04725  Cholinergic synapse
bbub04727  GABAergic synapse
bbub04742  Taste transduction
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04911  Insulin secretion
bbub04912  GnRH signaling pathway
bbub04913  Ovarian steroidogenesis
bbub04914  Progesterone-mediated oocyte maturation
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04918  Thyroid hormone synthesis
bbub04921  Oxytocin signaling pathway
bbub04923  Regulation of lipolysis in adipocytes
bbub04925  Aldosterone synthesis and secretion
bbub04926  Relaxin signaling pathway
bbub04927  Cortisol synthesis and secretion
bbub04928  Parathyroid hormone synthesis, secretion and action
bbub04934  Cushing syndrome
bbub04935  Growth hormone synthesis, secretion and action
bbub04970  Salivary secretion
bbub04971  Gastric acid secretion
bbub04972  Pancreatic secretion
bbub04976  Bile secretion
bbub05032  Morphine addiction
bbub05163  Human cytomegalovirus infection
bbub05166  Human T-cell leukemia virus 1 infection
bbub05200  Pathways in cancer
bbub05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102408103 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102408103 (ADCY4)
   04371 Apelin signaling pathway
    102408103 (ADCY4)
   04020 Calcium signaling pathway
    102408103 (ADCY4)
   04072 Phospholipase D signaling pathway
    102408103 (ADCY4)
   04024 cAMP signaling pathway
    102408103 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102408103 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102408103 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102408103 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102408103 (ADCY4)
   04062 Chemokine signaling pathway
    102408103 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102408103 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102408103 (ADCY4)
   04912 GnRH signaling pathway
    102408103 (ADCY4)
   04913 Ovarian steroidogenesis
    102408103 (ADCY4)
   04915 Estrogen signaling pathway
    102408103 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102408103 (ADCY4)
   04921 Oxytocin signaling pathway
    102408103 (ADCY4)
   04926 Relaxin signaling pathway
    102408103 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102408103 (ADCY4)
   04918 Thyroid hormone synthesis
    102408103 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102408103 (ADCY4)
   04916 Melanogenesis
    102408103 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102408103 (ADCY4)
   04927 Cortisol synthesis and secretion
    102408103 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102408103 (ADCY4)
   04270 Vascular smooth muscle contraction
    102408103 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102408103 (ADCY4)
   04971 Gastric acid secretion
    102408103 (ADCY4)
   04972 Pancreatic secretion
    102408103 (ADCY4)
   04976 Bile secretion
    102408103 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102408103 (ADCY4)
   04727 GABAergic synapse
    102408103 (ADCY4)
   04725 Cholinergic synapse
    102408103 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102408103 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102408103 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102408103 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102408103 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102408103 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102408103 (ADCY4)
   04714 Thermogenesis
    102408103 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102408103 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102408103 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    102408103 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102408103 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102408103 (ADCY4)
   05163 Human cytomegalovirus infection
    102408103 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102408103 (ADCY4)
Enzymes [BR:bbub01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102408103 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102408103
NCBI-ProteinID: XP_006061513
Position
11
AA seq 1077 aa
MARLFSPRQPPSEDLFYETYYSLSQQYPLLLLLLLIVLLGLLALLPVAWASGRELAADPA
FLTTVLCALGGFSLLLVLASREQRLQRWTRPLSGLVWAALLALGHSFLFTGGVVSAWDQV
SFFLFVIFTVYAMLPLDMRDAITAGVTSSLSHLLILGLYLGPQPDSRPALLPQLAANAVL
FLCGNAAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
EEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPWAAEEDEKGTAGGLLSSLEGSKMRPSLLMTR
YLESWGAAKPFAHLSHVESPVSTSTPLPEKALSSFSPQWSLDRSRTMRGPDEELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTYRPPALTITYGITFLLFFLLLFICFSEYLMKCVLKGPKMLHWLPTLSVLVATRP
GLRVALGTATILLVFVMAITSLVFLPATSACPFQAPNVSSMASNLSWELPGSLPLISIPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLTASCSVFLHSHAWLSDCLIARLYLGTLDS
RPGVLKEPKLMGAVSFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESSINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTICSTYMAATGLNATSGQDAQQDAEQSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggcagccccccagcgaagacctcttctacgagacctac
tacagcctgagccaacagtacccactgctgctgctgctgctgctgatcgtgctcttgggg
ctcctggcgctgctccctgtggcctgggcaagtggcagggagctggccgcagacccagcc
ttcctgaccactgtgctgtgcgctctgggcggcttctcactgctgctggtcctggcttcc
cgggagcagcggctgcagcgctggacgcgccccctgtcgggcctcgtgtgggcagcactg
ctcgcactaggccacagcttcctgttcactgggggcgtggtgagcgcctgggaccaggtg
tcctttttcctttttgtcatcttcactgtgtatgccatgttgcccttggacatgcgggac
gccatcaccgcgggtgtcacctcctcactctcacacttgctgatccttgggctgtatctt
gggcctcagcctgactctcggccggcgctgctgccacagctggctgcaaacgcggtgctg
ttcctgtgcgggaacgcggccggagcctatcacaaggcgctgatggagcgcgcgctgcgc
gccacgttccgggaggcgcttagttccctgcactcgcggcggagactggacaccgagaag
aagcatcaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gaggagatcatggcacgactgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcgactggccagtgagtgctcccctaaggagttggtgcttatgctcaacgag
ctctttggcaagttcgaccaaatcgccaaggagcacgaatgcatgcggatcaagatccta
ggagactgttactactgtgtctccgggctgccgctctcactgcctgaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccacaggc
gtggatatcaacatgcgtgtgggcgtgcactcaggcagcgtgctctgcggggtcatcggg
ctacagaaatggcagtatgatgtctggtcccatgatgtcactctggccaaccacatggag
gcgagtggcgtgccaggacgagtacatatcacaggggctacgctggccctgctggccggg
gcttatgctgtggaggatgcagccatggaacaccgggacccataccttcgggagctaggg
gagccgacctacctggtcatcgacccctgggctgcagaggaggacgagaagggcactgca
ggagggttgctgtcctctcttgagggctccaagatgcgtccatcactgctgatgacccgc
tacctggagtcctggggtgcagccaagcctttcgcccacctgagccacgtagagagccct
gtgtccacatctacccctctcccggagaaggccctgtcttccttcagcccccagtggagc
ctggaccggagccgtaccatgcggggacctgatgaggaactagacactggggatgccaag
ttcttccaggtcatcgaacagctcaattctcagaaacagtggaaacagtcaaaggacttc
aatccactgacactgtacttcagagagaaggagatggagaaagagtatcggctctctgca
ctccccgccttcaaatactatgcagcctgcaccttcctggtttttctctccaacttcatt
atccagatgctggtgacatacaggcctccagctctgaccatcacctatggcatcaccttc
ctcctcttcttcctcctcctcttcatctgcttctcagagtacctgatgaagtgtgtcttg
aaaggccccaagatgctgcactggctacctaccctgtctgtcctggtggccacacggcca
ggactgcgagtggctctgggcaccgctaccatcctgctcgtcttcgtcatggccattacc
agtctggtcttcttaccagcaacatcagcctgccctttccaggctcccaatgtgtcctcc
atggcttccaacctctcctgggagctccctgggtccctgcctctcatcagcatcccatac
tccatgcactgctgcgtgttgggcttcctctcctgctccctcttcctgcacatgagcttt
gagctgaagctgctgctgctcttgctgtggttgacggcctcctgctccgtcttcctgcac
tcccacgcctggttgtccgactgcctcatcgcccgcctctacctgggcaccttggactcc
aggccaggggtactgaaggagcccaaactgatgggagcagtctccttcttcatcttcttc
ttcaccctcctagtcctggctcggcagaacgaatattactgccgcctggactttctgtgg
aagaagaagctgaggcaagagcaggaggagacggagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggtcagaatcggcgc
aatgaggacctctaccaccagtcctatgagtgtgtgtgtgtcctcttcgcctcggtccca
gacttcaaggagttctactctgaatccagcatcaatcatgaggggctagagtgtctgcgg
ctgctcaatgagataatcgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaaaactatctgcagcacctacatggcagctaccggcttgaacgccacc
tctggacaggatgcacagcaggatgctgagcaaagctgcagccaccttggcaccatggta
gagtttgctgtggcccttgggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcttgcgtgtagggttaaaccacggacctgtagtggctggagtgattggggcccag
aaaccacaatatgacatctggggcaacacggtgaacgtggccagccgcatggagagcaca
ggtgtcctgggcaagattcaggtaacagaagagacagcctgggccctgcagtccttaggc
tacacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcttgaatacagatttgacacgaactggacctccctcagccaccctaggctga

DBGET integrated database retrieval system