KEGG   Bubalus bubalis (water buffalo): 102408203Help
Entry
102408203         CDS       T05912                                 

Gene name
SUCLA2
Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00020  Citrate cycle (TCA cycle)
bbub00640  Propanoate metabolism
bbub01100  Metabolic pathways
bbub01200  Carbon metabolism
Module
bbub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102408203 (SUCLA2)
   00640 Propanoate metabolism
    102408203 (SUCLA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102408203 (SUCLA2)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     102408203 (SUCLA2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     102408203 (SUCLA2)
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102408203 (SUCLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-GeneID: 102408203
NCBI-ProteinID: XP_006060899
Position
13
AA seq 463 aa AA seqDB search
MAASVFYSRLLAAATLRSHRPLTALPAAAQVLGSSGLFNNHGVQIQHQQQRNLSLHEYLS
MELLQEAGVSIPKGHVAKSPDEAYAIAKKLGSKDVVIKAQVLAGGRGKGTFESGLKGGVK
IVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERRYPRREYYFAITMERSFQGP
VLIGSSHGGVNIEDVAAETPEAIVKEPIDIVEGIKKEQAVRLAQKMGFPASIVDSAAENM
IKLYDLFLKYDATMVEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDER
DKDAAKADLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATVHQVTEA
FKLITSDKKVLSILVNIFGGIMRCDVIAQGIVMAVKDLEIKIPIVVRLQGTRVDDAKALI
ADSGLKILACDDLDEAAKMVVKLSEIVTLAKQAQVDVKFQLPI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctccgtgttttacagccggctcttggctgccgccaccctgaggagccaccga
cccctaacggcgctgccggccgccgcccaggtcctgggaagctctggattgtttaacaac
catggagtccaaatacagcatcaacagcaaaggaatctctcgctgcatgaatacctgagt
atggaattgttgcaggaagctggcgtctccattcccaaaggacatgtggctaagtcacca
gatgaagcttatgcaattgccaaaaaattaggttcaaaagatgttgtgataaaggcgcaa
gttttggctggtggcagaggaaaaggaacatttgaaagtggcctcaaaggaggagtgaag
atagttttctctccagaagaagcaaaagctgtttcctcacaaatgattgggaaaaagttg
tttaccaagcaaacaggagaaaagggcaggatatgcaatcaagtattggtttgtgaacga
agatatcccaggagagaatactactttgcaatcacaatggaaaggtcatttcaaggtcct
gtattaataggaagttctcacggtggtgtcaacattgaagatgttgctgctgagactcct
gaggccatagttaaagagcctatcgatatcgtagaaggcatcaaaaaggaacaagctgtc
cggcttgcacagaagatgggatttccagccagtattgtggattctgcagcagaaaacatg
atcaagctttatgacctttttctgaaatacgatgcaaccatggtagaaataaatccaatg
gtagaggattcagatggagctgtgctgtgtatggatgcaaagatcaattttgattctaat
tcagcttatcgtcagaagaaaatctttgacctgcaggactggacccaggaagatgaaagg
gacaaagatgcagctaaggcagatctcaactacattggccttgacggaaatatcggctgt
ctagtgaatggtgctggtttggctatggctacaatggatataataaaactccatggaggg
actccagccaactttcttgatgttggtggtggtgccacagtccatcaagtaacagaagcg
tttaaacttatcacttcagataaaaaggtactatctattttggtcaacatttttggagga
atcatgcggtgtgacgttattgcacagggtatagtcatggcagtaaaggatttggaaatt
aaaatacctattgtggtacggttacaaggtacacgagttgatgatgctaaggcactgata
gcggacagtggacttaaaatccttgcttgtgatgacttggacgaagctgctaaaatggtt
gtgaagctctctgagatcgtgaccttagccaagcaagcccaggtggatgtgaaatttcag
ttgccaatctga

DBGET integrated database retrieval system