KEGG   Bubalus bubalis (water buffalo): 102409119Help
Entry
102409119         CDS       T05912                                 

Gene name
PRODH2
Definition
(RefSeq) hydroxyproline dehydrogenase isoform X2
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00330  Arginine and proline metabolism
bbub01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102409119 (PRODH2)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     102409119 (PRODH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 102409119
NCBI-ProteinID: XP_006068845
Position
18
AA seq 461 aa AA seqDB search
MLQTCRVFCSRAGPSPGSLQPLSFDGGAFHLKSTGELTRALLVLRLCAWPPLVTHGLALQ
AWSQRLLGSRLSGALLRASIYGQFVAGETPEEVRSCVLQLQNLGLRPLLAVPTEEEPDSA
VKTGEAWYEGNLSAMLRCVDLSRGLLETPDPTGNALMQLKMTALMSTRLCKQLTSWVRRP
GDSLELSPERLAEAMDSGQDLRVSCLNTEQTRHLQASLSRLHRVVQHARAQRVRLLVDAE
YTSLNPALSLLVAALATRWNSSGEGGPWVWNTYQAYLKDTYERLRRDAEAADRAGLAFGV
KLVRGAYLDKERETARLQGTEDPTQPDYEATSQSYSLCLELMLTQVSHRGPMCHLMVASH
NEDSVHQATKRMWELGIPPDGPVCFGQLLGMCDHVSLALGQAGYAVYKSIPYGSLEEVIP
YLIRRAQENRSVLRGARREQELLSQELRRRLLGRGLRVSPH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagacctgtcgtgtgttctgctcccgagctggcccctccccggggagcttgcag
cccctcagctttgatggtggggccttccacctcaagagcacgggagaactgacccgggct
ttgctggtgctacggctgtgtgcctggccgcctctggtcacccatggcctggcgctccaa
gcctggtctcagcgactcctgggctcccggctctccggtgcgcttctccgagcatccatc
tacgggcagtttgtggctggtgagacccccgaggaggtgaggagctgtgtcctacagctc
cagaacctaggcctgcggcctctgctggcagtgcccactgaggaggagccagactcggct
gtcaagacgggcgaggcctggtatgaagggaacctcagtgcgatgctgcgatgcgtggac
ctgtcacgaggcctcctggagacccctgacccgacgggaaatgccctgatgcagctgaag
atgacggcgctgatgagcactcggctctgtaagcagctcacctcgtgggtccgaaggcca
ggggattctttggagctgagccccgagaggctggcagaagccatggactctggacaggac
ctccgggtctcctgcctcaacaccgagcaaacacgacacctccaggcctccctgagtcgc
ttgcaccgggtggtacagcacgcccgggcccagcgtgtgaggctcctggtggatgctgag
tacacctccctgaacccggcactctctctgctggtggctgccctggccacgcgctggaac
agctccggggaaggggggccctgggtgtggaacacttaccaggcctatctgaaggacacc
tacgagcggctgaggcgggacgctgaggctgcagacagggctggcctggcctttggggtg
aagttggtacgaggggcatatctggacaaggagagagagacggcccggctccagggaacc
gaagatcccactcagcctgactatgaggctaccagtcagagttacagcctctgtctggag
ctgatgctgacccaggtgtcccatcgtggccccatgtgccacctgatggtggcttcccac
aatgaggactctgttcaccaggcaaccaagcgcatgtgggagctgggcattcctccagat
gggccagtctgctttggacaacttctggggatgtgtgaccatgtctccttggcactgggg
caggctggctatgctgtgtacaagtccatcccctatggctccctggaggaggtgatccct
tacctgatccggagggcccaggagaaccgaagtgtactacggggtgcccgcagggaacag
gagctgctcagccaagaacttcgacggaggctgctggggcggggcctgagggtatccccc
cattag

DBGET integrated database retrieval system