KEGG   Bubalus bubalis (water buffalo): 102411106Help
Entry
102411106         CDS       T05912                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00600  Sphingolipid metabolism
bbub01100  Metabolic pathways
bbub04020  Calcium signaling pathway
bbub04071  Sphingolipid signaling pathway
bbub04072  Phospholipase D signaling pathway
bbub04370  VEGF signaling pathway
bbub04371  Apelin signaling pathway
bbub04666  Fc gamma R-mediated phagocytosis
bbub05152  Tuberculosis
Module
bbub_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102411106 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102411106 (SPHK1)
   04371 Apelin signaling pathway
    102411106 (SPHK1)
   04020 Calcium signaling pathway
    102411106 (SPHK1)
   04072 Phospholipase D signaling pathway
    102411106 (SPHK1)
   04071 Sphingolipid signaling pathway
    102411106 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102411106 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102411106 (SPHK1)
Enzymes [BR:bbub01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     102411106 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 102411106
NCBI-ProteinID: XP_006045366
Position
3
AA seq 489 aa AA seqDB search
MPVRAAPGAWSQKLTGCPPPQGAAPDSTSAVSSPSDPATTGNDAGAPTAPATGGEGEPQS
RHREARLGSTDKGLKSGAAAADSVRTAPGTPRQRGEVMDAAGGSRNLLPRPCHVLVLLNP
RGGKGKALQLFWSHVQPLLAQADVSFTLMLTERRNHARELVRAEDLRRWDALVVMSGDGL
IHEVVNGLMERPDWETAIQKPLCSLPAGSGNAVAASLNYYAGYEQVTKEDLLTNCTQLLC
QRLLAPMDLLSLQTACGQRLFSVLSLAWGFIADVDLESEKFRRLGEMRFTLGTCLRLMAL
RTYRGSLAYLPAETLASGRGPSLAQAPQGPADTHVVPLEQPVPPHWTVVPEQDFVLVLAL
LHSHLASDLFTAPMGRCSAGAMHLFYVRAGVSRATLLRLFLAMEKGRHMECHCPHLVYVP
VVAFRLEPKDGKGVFAVDGELLITEAVQGQVLPNYFWMVSGYREPPPSLKPQPSPRRKSQ
QTPPPSECP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcgcgcggctcccggagcgtggtcccagaaactaacggggtgccccccacct
cagggggccgctccagactccaccagcgcggtttcctctccctcagatccggcaaccaca
gggaatgacgcgggtgcccccacagccccggcaacgggcggggagggcgagccccaaagc
cgtcaccgagaggcccgcctgggcagcaccgataaggggctgaagtcaggagccgctgcg
gcggacagcgtccggacagcgccggggacccctcggcagcggggcgaggtcatggatgca
gcgggcggctcccggaacctgctcccaaggccctgccacgtgctggtgttgttaaatccg
cgcgggggcaagggcaaagccctgcagctcttctggagccacgtgcagccgttgctggcc
caggccgacgtctccttcacgctgatgctcactgagcggcggaaccacgcccgggagctg
gtgcgcgcggaggacctgagacgctgggacgcgctggtggtcatgtccggagacgggctg
atccacgaggtggtgaacgggctcatggagcggcctgactgggagaccgccatccagaag
cccctgtgtagcctcccggccggctctggcaatgcagtggccgcttctttgaactattac
gccgggtacgagcaggtgactaaggaagacctcctgaccaactgcacgcagctgctgtgc
cagcggctgctggcgcccatggacctgctatccctgcagacggcctgtgggcagcgcctc
ttctctgtgctcagcctggcgtggggtttcatcgccgacgtggatctggagagcgagaag
tttcggcgcctgggcgagatgcgcttcactctaggcacctgcctgcgcctgatggccctg
cgcacctaccggggcagcctggcctacctgcccgcagaaacgctggcttccgggaggggc
ccctccttggctcaggccccgcagggccccgcggacacccatgtggtgcccctggagcag
ccagtgccccctcactggacggtggtgccagagcaggactttgtgctggtgttggcactc
ctgcactcccacctggccagtgaccttttcaccgcccccatgggccgctgttcggccggc
gccatgcatctgttctacgtgcgtgctggcgtgtcccgggccacgctgctgcgcctcttc
ctggccatggagaaaggcaggcacatggagtgccactgcccccacctggtatatgtgcct
gtggttgccttccgtctggagcccaaggatgggaagggtgtgtttgctgtggatggggaa
ctgctgatcaccgaggctgtccagggccaggttctccccaactacttctggatggtcagt
ggctacagggagcccccaccctctctgaaaccgcagccctcaccccgcaggaagtctcag
cagacgccgcccccatcagagtgcccctga

DBGET integrated database retrieval system