KEGG   Bubalus bubalis (water buffalo): 102411220Help
Entry
102411220         CDS       T05912                                 

Gene name
TNFRSF13C
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 13C isoform X1
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04060  Cytokine-cytokine receptor interaction
bbub04064  NF-kappa B signaling pathway
bbub04672  Intestinal immune network for IgA production
bbub05166  Human T-cell leukemia virus 1 infection
bbub05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102411220 (TNFRSF13C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102411220 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    102411220 (TNFRSF13C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102411220 (TNFRSF13C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102411220 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bbub04050]
    102411220 (TNFRSF13C)
   04090 CD molecules [BR:bbub04090]
    102411220 (TNFRSF13C)
Cytokine receptors [BR:bbub04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102411220 (TNFRSF13C)
CD molecules [BR:bbub04090]
 Proteins
  102411220 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind TACI-CRD2
Motif
Other DBs
NCBI-GeneID: 102411220
NCBI-ProteinID: XP_025138559
Position
4
AA seq 219 aa AA seqDB search
MQRGRRSLRGKDRPAPTQCLQTQCFDPLVRNCVACSLLRTTGPRLASPSSGPPPPHTPLP
SAPCSPCPSPPAGDPSSLAPGTALQPQESAGPGTPAEAEAALPLPALLFGAPALLGLALA
LALLGLVTWKRRRRQPGAAVVPEAPEAAEVPEAPDGDPDKPLDVDTTLSPGTLDATAPIW
LLPSEDPAATPPTHSVPVPATELGSTELVTTKTAGPELQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgagggcggagaagcctgcggggcaaggaccggccggcacccacgcagtgcctg
cagacccagtgcttcgacccgctggtccgcaactgtgtggcctgcagtctcctccggacg
acggggcctagactggcctcaccttcctccggccctccccctccccacaccccccttccc
tccgccccctgctccccctgcccgtcccctccagcaggcgacccgagcagcctggcgccc
gggacggcgctgcagccgcaggagtcggcgggcccggggacccccgcggaggccgaagcg
gcgctgcctctccctgcgctgctcttcggggcccccgcgctgctgggccttgcgctggcc
ctggccctgctcgggctggtgacctggaagcgccggcggcggcagccgggagcggcggtg
gtccccgaggctccggaggccgcggaggtcccggaggccccggacggagacccagacaag
cccctggatgttgataccacactctcccccggaaccctggatgccacggctcccatctgg
cttctgcccagtgaagacccagcggccaccccacctacccacagcgtccctgtgccagcc
acagagctgggttccactgagctggtgaccaccaagacggccgggcctgagctacagtag

DBGET integrated database retrieval system