KEGG   Bubalus bubalis (water buffalo): 102411960Help
Entry
102411960         CDS       T05912                                 

Gene name
HSPA6
Definition
(RefSeq) heat shock 70 kDa protein 6
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub03040  Spliceosome
bbub04010  MAPK signaling pathway
bbub04141  Protein processing in endoplasmic reticulum
bbub04144  Endocytosis
bbub04213  Longevity regulating pathway - multiple species
bbub04612  Antigen processing and presentation
bbub04915  Estrogen signaling pathway
bbub05134  Legionellosis
bbub05145  Toxoplasmosis
bbub05162  Measles
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102411960 (HSPA6)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102411960 (HSPA6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102411960 (HSPA6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102411960 (HSPA6)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102411960 (HSPA6)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102411960 (HSPA6)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102411960 (HSPA6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102411960 (HSPA6)
  09172 Infectious disease: viral
   05162 Measles
    102411960 (HSPA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102411960 (HSPA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bbub01009]
    102411960 (HSPA6)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bbub03041]
    102411960 (HSPA6)
   03009 Ribosome biogenesis [BR:bbub03009]
    102411960 (HSPA6)
   03110 Chaperones and folding catalysts [BR:bbub03110]
    102411960 (HSPA6)
   04131 Membrane trafficking [BR:bbub04131]
    102411960 (HSPA6)
   03051 Proteasome [BR:bbub03051]
    102411960 (HSPA6)
   03029 Mitochondrial biogenesis [BR:bbub03029]
    102411960 (HSPA6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102411960 (HSPA6)
Protein phosphatases and associated proteins [BR:bbub01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102411960 (HSPA6)
Spliceosome [BR:bbub03041]
 Complex B
  Other components
   Prp19 complex
    102411960 (HSPA6)
 Complex C
   Prp19-CDC5 complex
    102411960 (HSPA6)
Ribosome biogenesis [BR:bbub03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102411960 (HSPA6)
Chaperones and folding catalysts [BR:bbub03110]
 Heat shock proteins
  HSP70 / DNAK
   102411960 (HSPA6)
Membrane trafficking [BR:bbub04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102411960 (HSPA6)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102411960 (HSPA6)
Proteasome [BR:bbub03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102411960 (HSPA6)
Mitochondrial biogenesis [BR:bbub03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102411960 (HSPA6)
Exosome [BR:bbub04147]
 Exosomal proteins
  Proteins found in most exosomes
   102411960 (HSPA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C AAA_33 Hydantoinase_A DNApol_Exo
Motif
Other DBs
NCBI-GeneID: 102411960
NCBI-ProteinID: XP_006041196
Position
6
AA seq 643 aa AA seqDB search
MSAARELAIGIDLGTTYSCVGVFQHGRVEILANDQGNRTTPSYVAFSDTERLVGDAAKSQ
AALNPHNTVFDVKRLIGRRFTDPTVQSDMKHWPFQVVSEGGKPKVRVSYRGEDKAFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRLGAGERNVLIFDLGGGTFDVSVLTIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSRNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLGKAQIHDIVLVGGSTRIPKVQKLLQDFFNGRE
LNKSINPDEAVAYGAAVQAAVLMGDTCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVREAEQYKAEDEAQRDRVAA
KNSLEAYVFHVKSSLQEERLRDKIPEEDRHKVQDKCQEVLAWLEHNQLADKEEYEHQKRE
LEQICCPIFSRLYGGPGVPVGSSCGAQARHGAPSTGPVIEEVD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcgagggagctggccataggcatcgacctgggcaccacgtactcgtgcgtg
ggcgtgttccagcacggccgggtggagatcctcgccaacgaccagggcaaccgcaccacc
cccagctacgtggccttctcagacaccgagcggctggtgggcgacgcggccaagagccag
gcggccctgaacccgcacaacaccgtgttcgacgtcaagcgactgatcgggcgcaggttc
acagaccccactgtgcagtcggacatgaagcactggcccttccaggtggtgagcgagggc
ggcaagccgaaggtgcgcgtgtcctaccgcggggaggacaaggcgttctaccccgaggag
atctcgtccatggtgctgagcaagatgaaggagacggcggaggcgtacctgggccagccc
gtgaagcacgctgtaatcacggtgcctgcctacttcaacgactcgcagcgtcaggccact
aaggacgcgggtgccatcgcggggctcaacgtcctgaggatcatcaacgagcccacggca
gctgccatcgcctacggcctggaccggctgggcgccggagagcgcaacgtgctcattttc
gacctgggtgggggcaccttcgacgtgtcggtcctcaccatcgacgctggtgtctttgag
gtgaaggccacggctggagacactcacctgggtggagaggacttcgacaaccggctggtg
aaccacttcatggaggagttccggcggaagcatgggaaggatttgagcaggaacaagcgg
gccctgcgcaggctccgcacggcctgcgagcgcgccaagcgcaccctgtcgtccagtacc
caggccactctggagatcgattccctgtttgagggtgtagacttctacacttctatcact
cgagcccgctttgaagaactgtgctcggacctcttccgcagcaccctggagccggtggag
aaggccttgcgggatgccaagctgggcaaggcccagatccatgacattgtcctggtgggt
ggctctacccgaatccccaaggtacagaagctcctgcaggacttcttcaatggcagggag
ctgaacaaaagcatcaacccggatgaagctgtggcttatggggctgctgtgcaggcagcc
gtgttgatgggggacacgtgtgagaaggtgcaagatctgctgctgctggatgtggctccc
ctgtccctagggctggagacagctggtggggtgatgactacactgatccagaggaatgcc
actatcccaaccaagcagacccagactttcaccacctattcagacaaccagcctggggtc
ctgattcaggtgtacgagggtgagagggccatgaccagggacaacaacctgctagggcgc
tttgagctcagcggcatccctcctgccccacgtggagtcccccagatcgaggtgaccttc
gacattgacgccaatggcatcctgagtgtgacagccactgacaggagcacaggcaaagct
aacaagatcaccatcaccaatgacaagggccggctgagcaaggaggaggtggagaggatg
gttcgtgaggctgagcagtacaaggctgaggatgaggcccagagagacagggtggctgcc
aaaaactctctggaggcctatgtcttccatgtgaagagctccttgcaagaggagaggctt
agagataagattcctgaagaggacaggcacaaagtacaagacaagtgtcaggaagtcctt
gcttggctggagcacaaccagttagcagacaaagaggaatatgagcatcaaaagagggag
ctggagcagatctgttgccccatcttctccaggctctatggggggcctggtgtccctgtg
ggcagcagttgtggagctcaagcccgacatggagcccctagtactggccctgtcattgag
gaggtcgattaa

DBGET integrated database retrieval system