KEGG   Bubalus bubalis (water buffalo): 102412518Help
Entry
102412518         CDS       T05912                                 

Gene name
IDH1
Definition
(RefSeq) isocitrate dehydrogenase [NADP] cytoplasmic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00020  Citrate cycle (TCA cycle)
bbub00480  Glutathione metabolism
bbub01100  Metabolic pathways
bbub01200  Carbon metabolism
bbub01210  2-Oxocarboxylic acid metabolism
bbub01230  Biosynthesis of amino acids
bbub04146  Peroxisome
Module
bbub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbub_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102412518 (IDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102412518 (IDH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102412518 (IDH1)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     102412518 (IDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 102412518
NCBI-ProteinID: XP_006044658
Position
2
AA seq 414 aa AA seqDB search
MSQKIQGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEISYTPSDGSPKTVYLVHNFTESGGVAM
GMYNQDKSIEDFAHSSFQMALSKNWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSEFE
AQNIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELSFFAKALE
EVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLQLKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaaaaatccaaggcggatctgtggtagagatgcaaggagatgaaatgacacgg
atcatttgggagttgattaaagagaaactcatttttccctacgtggaactggacctgcac
agctacgatttgggcatagagaatcgcgatgccaccaatgaccaggtcaccaaggacgct
gcggaagccataaagaagtacaacgttggcgtcaagtgtgccaccatcaccccggatgag
aagagagtggaggagttcaagctgaaacaaatgtggaagtctccaaatggcaccatccga
aatatcctgggtggcactgtcttcagggaagctattatctgcaaaaatataccccggctt
gtgagcggatgggtaaaacccattatcataggtcgtcatgcgtatggggatcaatataga
gcaaccgattttgttgtgccagggcctggaaaagtagagatatcctacacaccaagcgat
ggatcccccaaaacggtatacctagtacataacttcacagagagtggtggtgttgccatg
gggatgtacaatcaagataagtccatcgaagattttgcacacagttctttccagatggct
ttgtctaagaattggcctttgtatctgagcaccaaaaacactattctgaagaaatacgat
ggacgttttaaagacatctttcaggagatatatgacaagcagtacaaatctgagtttgaa
gctcagaatatctggtatgagcacaggcttattgatgacatggtggcccaagctatgaaa
tcggaggggggcttcatttgggcctgtaagaactatgatggggacgtgcagtcagactcc
gtggcccaaggttatggctctctcggcatgatgaccagtgtgctggtttgtccagatggc
aagacagtagaagcagaggctgcccacgggactgtaacccgtcactaccgaatgtaccag
aaaggacaggagacatccaccaatcccattgcttccatttttgcctggaccagaggctta
gcccacagagctaagcttgataacaataaagagctcagcttttttgcaaaggctttggaa
gaagtctgtattgagaccattgaggctggcttcatgaccaaggacttagctgcatgtatt
aaaggtttacccaacgtgcaacgttctgactacttgaatacatttgagttcatggataaa
ctcggagagaacctacagttaaaactagcccaggccaaactttaa

DBGET integrated database retrieval system