KEGG   Bubalus bubalis (water buffalo): 102412616
Entry
102412616         CDS       T05912                                 

Gene name
ADAMTS13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
bbub  Bubalus bubalis (water buffalo)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bbub01002]
    102412616 (ADAMTS13)
Enzymes [BR:bbub01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102412616 (ADAMTS13)
Peptidases and inhibitors [BR:bbub01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102412616 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_CCN TSP1_spondin Reprolysin_5 Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 102412616
NCBI-ProteinID: XP_025118223
Position
12
AA seq 1410 aa
MAPSVPGRCVRGTLTSALFFLSCWTLPDPRQQFLQALEPADVTSYFGPDAAFEGPRLSAL
PTPSPGRPPAPRLRRQAAGHVLHLELLVAVGPDVHRTHGEETERYVLTNLNMGSELLRDP
SLGAQFRVHLVKMVILTQPEDAPKITANITASLLSVCEWSRTVNPEDDTDPRHADLVLYI
TRFDLELPDGNRQVRGVTQLGGACSSSWSCLITEDTGFDLGLTIAHEIGHSFGLEHDGVP
GSGCGPSGHVMASDGAAPALALGGPAWSPCSRRQLLSLLSAGRARCVWDPPGPLSGPAGQ
PPEVQPGLYYGADEQCRVAFGPTAVACTFRGEHLDMCQALSCHTDPLDPSSCSRLLIPLL
DGTECGVGKWCSKGHCRSLAELAPVRVVHGHWSGWGPASPCSRSCGGGVITRRRRCNNPR
PAFGGRTCIGSDLQAEMCNTQACEKTQLEFMSEQCAQTDSEPLRLSPGGSATFYRWGTAE
QYSEGNALCRHVCRAVGESFMVRRGDRFLDGTRCVPGDPQEDGALRLCVSGSCRTFGCDG
RMDSGQVRDVCQVCGGDNSTCQPQSGSFTAGRAREYVTFLTVTPNLTSIYVINRRPLFTH
LAVRVCGRYVVAGNGSASASTSYPSLLEDSRVEYRVTLSEDRLPRREEIRIRGPTRDDME
IQVYRRYGEEYGSPARPDITFTYFQPEQRQAWVWAPMRGPCSVSCGAGLRQVTYSCRDQS
RSEWVEAARCAGSRPPAAWSETCAPEPCPPHWEAGDFGPCSASCGGGLLEREVRCVEARG
GLLRTAPRSRCRALAPQPAAVDTCNSQPCPQRETDVCSSACGADPAVQNTTCVPGADGTG
LSAAAGPCSADEKLPALEPCVEAACPPSWDQLDVQPPGREAASPAGGPGLEVLAAHVWTP
LAGPCSVSCGQGLAELRFVCMDPALRTPVQEELCDLASKPGSRREACQAAPCPARWRYKL
AACSLSCGGGVAQRILYCARAHGEDTDEEILPDTQCQGLPRPEQQEACSPEPCPPRWKVT
SLGPCSASCGLGTATRSLACVRLDRGQDTEVDEAACAGLVQPQASIPCIVADCAYRWHVS
AWTQCSVSCGEGIQHRHDACLGPGAQVPVPADFCQHLPKPVTVRGCQAGPCVGQGMASPA
PHEEATAPGQTTAATAASPEWPQPHARLLSPAQGRLPGPQESPVETSVCGRQHLGPTGII
DMRGTARPDCAVAIGRPLGEVVTLRFLEGSLNCSAGEMLLLWGRLVWRKMCGKPAGMAFS
SQANTLLVRQRLVRPGGGVLLRYSSQPALGAFHRGCDMQLFGPRGEISSPSMSPGGRNVG
GCRIFIDVAPQARIAIHALTVDSGTRAKGTDASYILIRDIHSLRTTAFRGQKTLYWESEG
SQAEMEFSQGFLEAHASLRGQYWTLHTRAG
NT seq 4233 nt   +upstreamnt  +downstreamnt
atggctccctccgtgccggggagatgtgtgcgggggaccctcacttctgcgctcttcttc
ctgagctgctggacgctccctgatccccggcagcagtttctgcaggccctggagccagcg
gacgtgacctcttactttggccccgatgctgcctttgaaggaccccggctctcagccctg
cccactccctcaccaggccgtccccctgcccctcgcctccggagacaggccgccgggcac
gtcctgcacctggagctgctggtggccgtgggtcctgacgtccaccggacccacggggag
gagacggagcgctacgtgctcaccaacctcaatatggggtcagagctgctgagggaccca
tctctgggggctcagttccgagttcacctggtgaagatggtcatcctgacccagcctgag
gatgctccaaagatcacagccaacatcactgcgtcgctgctgagcgtctgtgaatggagc
aggacagtcaaccctgaggacgacacggaccccaggcatgctgacctggtcctgtacatc
accaggtttgacctggaattgcccgatggtaaccggcaggttcggggggtcacccagctg
gggggcgcctgctcctcctcctggagctgcctaatcactgaggataccggctttgacctg
gggctcaccatcgcccatgagattgggcacagcttcggcctggagcacgacggcgtgccg
ggcagcggctgcgggcccagcggccacgtgatggcctcggacggcgcggcgcccgccctc
gccctcgggggcccggcgtggtccccctgcagccgccggcagctgctgagtctgctcagc
gcaggacgggcgcgctgcgtgtgggaccctccggggccgctgtccgggcccgcggggcag
cctcccgaggtgcagcccggcctctactatggcgcggacgagcagtgccgcgtcgccttc
ggccccacggcggtcgcctgcaccttccgcggggagcacctggacatgtgccaggctctc
tcctgccacacagaccccctggacccaagcagctgtagccgcctgcttattcctctcctg
gacgggacagagtgtggcgtggggaagtggtgctccaagggtcactgccgctcgctggcg
gagctggcccccgtgagggtggtgcacgggcactggtctggctgggggcccgccagtcct
tgctcccgctcctgcggaggcggcgtgatcaccaggagacggcggtgcaacaaccccaga
cctgcctttggggggcgcacgtgcataggttctgacctccaggccgagatgtgcaacacc
caggcctgcgagaagacccagctggagttcatgtctgagcagtgtgcgcagacggacagc
gagcccctgcgcctctccccgggaggcagcgccaccttctaccgctgggggaccgcagag
cagtacagtgaagggaacgccctgtgcagacacgtgtgccgggccgtcggcgagagcttc
atggtgcggcgtggggaccgtttcctggatggcacgcgctgtgtgccgggcgaccctcag
gaggatggggccctgaggctgtgcgtgtcgggcagctgcaggacgtttggctgtgatggc
aggatggactccgggcaggtgcgggacgtgtgccaggtgtgcggcggggacaacagcacg
tgccagccacagagcggctccttcacggccggaagggccagagagtacgtcacattcctg
accgtcacccccaacctcaccagcatctacgtcatcaaccgcaggcctctcttcacacac
ctggcagtgagggtgtgtggccgctacgtcgtggctggaaacgggagcgcgtctgccagc
accagctacccctccctcctggaggacagccgtgtggagtacagggtgaccctgagcgag
gaccggctgccccgccgggaggagatccgcatccggggccccacccgggacgacatggag
atccaggtttacaggcgctacggcgaggagtacggcagccccgcccgccctgacatcacc
ttcacctacttccagccggagcagcggcaggcctgggtgtgggccccgatgcgggggccc
tgctccgtgagctgcggggcagggctgcgccaggtgacctacagctgtcgggaccagtcc
aggagcgagtgggtggaggctgcccgctgtgcggggagccggcccccggcagcatggtca
gagacctgcgcccccgagccctgccccccgcactgggaggctggagacttcggcccctgc
agcgcctcgtgtgggggtggtctgctggagcgagaggtgcgctgcgtggaggcccggggc
ggcctgctgaggaccgctccccgctcccggtgcagagcgctggccccgcagccggcggcc
gtggacacctgcaattcccagccctgcccccagagggaaacagacgtgtgctcgtcggcc
tgtggtgcagacccggccgtgcagaacacgacgtgtgtgccgggggcagacggcacaggg
ctgtcggcagctgctgggccctgctccgcagacgaaaagctgcctgccctggagccctgt
gttgaggcggcgtgtcctcccagctgggaccagctggacgtccagcccccggggcgggag
gctgcgtccccagcgggcggccccgggctggaggtgcttgccgcgcacgtgtggacaccc
ctggcggggccctgctctgtctcctgtggtcaaggcctggcggaactgcgttttgtgtgc
atggaccctgccctcaggacgcccgtccaggaagagctctgtgacctggcaagcaagccc
gggagccggcgggaggcctgccaggctgccccgtgcccggcccggtggcggtacaagctg
gccgcttgcagcctgagctgtgggggaggggtggcgcagaggatcctgtactgcgcccgg
gcccacggcgaggacacggacgaggagatcctgccggacacccagtgccaggggctgccc
cgcccagagcaacaggaggcctgcagcccggagccctgcccccccaggtggaaagtcacg
tccctcggcccgtgctcggccagctgtgggctcggcacggccacacgctcgctggcctgt
gtgcggctggaccgcggccaggacacagaggtggacgaggcggcctgcgcaggtctcgtg
cagccacaggccagcatcccttgcatcgtcgccgactgtgcgtaccggtggcacgtcagc
gcctggacacagtgttctgtctcctgtggggagggcatccagcatcggcatgacgcctgc
ctaggacctggggcccaggtgcctgtgcccgccgacttctgccagcacctgcccaagcca
gtgaccgtgcggggctgccaggctgggccctgcgtggggcaggggatggccagcccggcg
ccccatgaggaggccactgctccaggccagaccacagctgccacagctgcgtccccagag
tggccccagccccacgcccgcctcctctccccagctcaaggacgcctgcccgggccccag
gaaagcccagtggagaccagtgtctgtggccggcagcaccttggaccaacgggaatcatc
gacatgcgaggcacggcacggccagactgtgcagtggccatcgggcggcccctgggtgaa
gtggtgaccctccggttcctggagggttctctcaactgcagtgctggggagatgctgctg
ctttggggcaggctcgtgtggaggaagatgtgcgggaagccggccggcatggctttcagc
tcccaagccaacacgctgctggtgaggcagcgtcttgtgcggcccggaggcggagtgctg
ctgcggtattcgagccagcctgccctgggagccttccaccgaggatgtgacatgcagctc
ttcggaccccggggcgaaatctcgagcccgtcgatgagtccaggtgggaggaacgtgggg
ggctgtcgcatcttcatcgacgtggccccgcaggcccggatcgccatccatgccctgacc
gtggacagtggcaccagagccaagggaactgatgccagttacatcttgatccgggacatc
cacagcctgaggacaacagcatttcgtgggcagaagacgctctactgggagtcagagggc
agccaggcagagatggagtttagccagggcttcctggaagcacacgccagccttcggggc
caatactggaccctccacacaagagctggttag

DBGET integrated database retrieval system