KEGG   Bubalus bubalis (water buffalo): 102412686Help
Entry
102412686         CDS       T05912                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00020  Citrate cycle (TCA cycle)
bbub00640  Propanoate metabolism
bbub01100  Metabolic pathways
bbub01200  Carbon metabolism
Module
bbub_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbub_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102412686 (SUCLG1)
   00640 Propanoate metabolism
    102412686 (SUCLG1)
Enzymes [BR:bbub01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     102412686 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     102412686 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 102412686
NCBI-ProteinID: XP_006055891
Position
12
AA seq 346 aa AA seqDB search
MTAAVAAARAAATMASGSSGLAAARLLSRAFLLQQNGIRHCSYTTSRKHLYVDRNTKIIC
QGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYV
PPPFAAAAIDEAIEAEVPLVVCITEGIPQQDMVRVKHKLLRQGKTRLVGPNCPGVINPGE
CKIGIMPGHIHKKGRVGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCL
EIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKAKPVVSFIAGLTAPPGRRMGHA
GAIIAGGKGGAKEKIAALQSAGVVVSMSPAQLGTTIYKEFEKRKML
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagccgtcgccgctgcccgtgccgctgcgaccatggcctctggcagcagcggc
ctcgcagccgcccgcctcctgtcccgcgccttcctcttgcaacagaatggaattcggcat
tgctcttatacaacttccaggaagcatctctatgttgatagaaatacgaagattatttgc
cagggtttcactggtaagcagggcacctttcatagccagcaggcactggaatatggcacc
aaactagttggaggaaccactccagggaaaggaggcaagacgcacctgggcttaccggtc
tttaacaccgtgaaggaggccaaagaacagactggggcgacagcatctgtcatttatgtc
cctcctccctttgctgctgctgccattgatgaagctatcgaggcggaagtgcccctggtc
gtgtgcatcaccgaaggtatcccacagcaggacatggtgcgggtcaagcacaaactgctg
cgccagggaaagaccaggctggtcgggccgaactgccctggagtcatcaatcctggagaa
tgcaaaattggcatcatgcctggccatattcacaagaaaggaagagtcggtatcgtgtct
agatccggcaccctgacttacgaagcggttcaccagacaacacaagttggattgggacag
tctttgtgtgttggcattggaggcgatcctttcaatggaacagactttacagactgcctt
gaaatctttctgaatgatccggccacagaaggcatcatattgattggtgaaattggtggt
aatgccgaagaaaatgctgcagaatttttgaagcaacataattcaggtcccaaggccaag
cctgtggtgtccttcattgctggtttaactgctcctcccggcagaagaatgggtcacgca
ggggcaatcattgctggaggaaaaggtggagctaaagagaagatcgcagccctgcagagt
gctggggttgtggtcagcatgtccccggcacagctgggaaccaccatctacaaggagttt
gaaaagaggaagatgctctga

DBGET integrated database retrieval system