KEGG   Bubalus bubalis (water buffalo): 102413503Help
Entry
102413503         CDS       T05912                                 

Gene name
DCXR
Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub00040  Pentose and glucuronate interconversions
bbub01100  Metabolic pathways
Module
bbub_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102413503 (DCXR)
Enzymes [BR:bbub01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     102413503 (DCXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase Shikimate_DH ADH_zinc_N NmrA RmlD_sub_bind DUF1776 Sacchrp_dh_NADP THF_DHG_CYH_C 2-Hacid_dh_C NAD_binding_7 TrkA_N DFP 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 102413503
NCBI-ProteinID: XP_025135511
Position
3
AA seq 244 aa AA seqDB search
MDLRLAGRRALVTGAGKGIGRSIVKALHAAGARVVAVSRTQADLDSLVRECPGVETVCVD
LADWEATEQALGGVGPVDLLVNNAAVACLQPFLEVTKEAYDMSFNVNLRAVIQVSQIVAR
GLIARGAPGVIVNVSSQASQRGLTNHSVYCSTKGALDILTKVMAVELGPHKIRVNAVNPT
VVMTPMGQAAWSDPQKAKAMLDRIPLGRFAEVENVVDTILFLLSDRSSMTTGSTVPVDGG
FLAT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggatttgagactcgcggggcgccgggcgctcgtcacgggggcgggcaaaggcatcggt
cgcagtattgtcaaggcgctacacgcggctggcgcccgagtggtggccgtgagccggacc
caggccgacctggacagcctggtccgcgagtgccccggggtagagaccgtgtgcgtggac
ctagctgactgggaggccacggagcaggcgctgggaggtgtcggccctgtggacctgctg
gtgaacaatgcagctgtggcgtgtctacagcccttcctggaggtcaccaaggaggcatat
gacatgtctttcaatgtgaaccttcgcgcggtcatccaggtgtcccagattgtggcccga
ggcctgatagctcggggagccccaggggtcatcgtgaatgtttctagccaggcctcccaa
cggggactgactaaccacagtgtctactgctccactaagggcgccttggacatactgacc
aaagtgatggctgtggagctggggccacacaagatccgtgtgaatgcagtcaaccccacg
gtggtgatgacacccatgggccaggccgcctggagtgaccctcagaaggccaaggccatg
ctggaccgcatcccccttggcaggtttgccgaggtggagaacgtggtggacaccattctc
ttcctgctcagtgaccgcagcagcatgaccacaggctccactgtgccagtggatgggggc
ttcctggctacctaa

DBGET integrated database retrieval system