KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0122Help
Entry
HMPREF9228_0122   CDS       T01844                                 

Definition
(GenBank) transcriptional regulator, LacI family
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_4 Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AEF26443
Position
complement(161285..162310)
Genome map
AA seq 341 aa AA seqDB search
MGKADIYQVAKEAGVSISTVSRAFTRPELVSAKTRRKVLDVADKLDFNISRSATALKSGQ
TYRVAMLMNEEITSWFNTQTFAGIESVMHPAGYDISLFQHIDTAANRHEFFTDLPIRRNV
DAVFVASFAIDPHEVEQLQRIHVPIIGINTPSSEGFDATISIDDEKGMYTAAQHLINLGH
KHIVYPCSEAAGLDSSIDARAQGFINVCKDAEGKHGINWEVLSVPRGPAFADSALSALLA
MDEFPDAICCQMDMMAIPLVLKLERYGHRTPRDYSIVGFDDSPYADTINLTTMRQDPYAM
GRAAANKALTLISGKTLYDPHEVLEAQLVPRSTDIPFGEMA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcagacatctaccaagtagccaaggaggccggagtctccatttctacagtg
tcgcgcgccttcacccgcccggaactcgtctcggcgaagacccgccgcaaggtgctggat
gtggccgataagctcgatttcaacatctcccgctctgccaccgccctaaagtccggacag
acctaccgtgtggcgatgctgatgaatgaggagatcaccagctggttcaatacgcaaacg
ttcgcgggcatcgaatcggtgatgcatccggccggctatgacatctcgctgttccagcac
atcgataccgccgcaaaccgtcatgagttcttcaccgacctgccgattcgccgcaatgtc
gatgccgttttcgtggcctcgttcgctatcgatccgcacgaggtcgagcagctgcagcgc
attcatgtgccgatcatcggcatcaatacgccgtcttccgaaggctttgacgccaccatc
agcatcgacgacgaaaagggcatgtacacggctgcgcagcatctcatcaacctcggtcac
aagcacatcgtctacccctgctctgaggcagccgggctggattcctcgattgacgcacgc
gcacagggcttcatcaacgtctgcaaggacgccgaaggcaagcatggcatcaattgggaa
gtgctctccgtgccgcgcggcccggccttcgccgactccgcattatccgcgctgctggcg
atggatgagttcccggacgcaatctgctgccagatggatatgatggcgattccgctggtg
ctcaagctggagcgttacggccaccgcacgccgcgcgattattcgattgtcggctttgac
gacagcccctatgccgacaccatcaacttgacgaccatgcgtcaggatccgtatgcgatg
ggccgcgcagctgccaataaggcgttgacgctcatcagcggcaagacgctctatgacccg
cacgaggtgctcgaggcacagctagtgccgcgcagcaccgatattccattcggggaaatg
gcgtaa

DBGET integrated database retrieval system