KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0126Help
Entry
HMPREF9228_0126   CDS       T01844                                 

Gene name
grpE
Definition
(GenBank) co-chaperone GrpE
  KO
K03687  molecular chaperone GrpE
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bbv03110]
    HMPREF9228_0126 (grpE)
   03029 Mitochondrial biogenesis [BR:bbv03029]
    HMPREF9228_0126 (grpE)
Chaperones and folding catalysts [BR:bbv03110]
 Heat shock proteins
  HSP24
   HMPREF9228_0126 (grpE)
Mitochondrial biogenesis [BR:bbv03029]
 Mitochondrial protein import machinery
  Matrix
   MMC/PAM proteins
    HMPREF9228_0126 (grpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GrpE
Motif
Other DBs
NCBI-ProteinID: AEF26863
Position
169847..170530
Genome map
AA seq 227 aa AA seqDB search
MSEFNKDDYLNDLPDPSDAEAAGQAAQASSGADASAESGSAQDSAAQAPSNEGADAAPAA
AEGEKSDAGKKTGEGQSDSEDTLTPLGKAKKEAADYLEALQRERAEFINYRNRAQKEQER
FRQHGIIDVLTALLPALDDIDRIRENSEMDDSFKAVAAKIDKAFEKFGVEKFGEKGEDFD
PTKHEAILHKPDADADKETVDTVVEAGYRIGDRVIRAARVVVASPQN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagttcaacaaggacgactacctgaacgacctgccggatccctcagatgctgag
gctgccggccaggccgctcaggcctcttcaggggctgacgcctccgccgagtccggctct
gcgcaggattcggctgcccaggctccttccaatgaaggagccgacgcggctcctgccgca
gctgagggagagaagtcggatgccggaaagaagactggcgaaggccagtccgattctgaa
gacaccctcacccctctcggcaaggccaagaaggaagccgccgactacctcgaagccctg
cagcgcgaacgcgcggagttcatcaactaccgcaatcgtgcgcagaaggagcaggagcgc
ttccgtcagcacggcattatcgacgtgctgaccgcgctgctgccggcccttgacgacatc
gaccgcattcgcgagaacagcgagatggacgattcgttcaaggcggtggctgccaagatc
gacaaggctttcgagaagttcggcgtcgagaagttcggcgaaaagggcgaggacttcgac
cccaccaagcatgaggcaatcctgcacaagccggatgccgatgccgacaaggaaaccgtc
gacaccgtggtggaagccggctaccgtatcggcgaccgcgtaatccgcgccgcccgagta
gtagtagcctccccgcaaaactga

DBGET integrated database retrieval system