KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0132Help
Entry
HMPREF9228_0132   CDS       T01844                                 

Definition
(GenBank) oxidoreductase, short chain dehydrogenase/reductase family protein
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00061  Fatty acid biosynthesis
bbv00780  Biotin metabolism
bbv01040  Biosynthesis of unsaturated fatty acids
bbv01100  Metabolic pathways
bbv01130  Biosynthesis of antibiotics
bbv01212  Fatty acid metabolism
Module
bbv_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HMPREF9228_0132
   01040 Biosynthesis of unsaturated fatty acids
    HMPREF9228_0132
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HMPREF9228_0132
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    HMPREF9228_0132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bbv01004]
    HMPREF9228_0132
Enzymes [BR:bbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     HMPREF9228_0132
Lipid biosynthesis proteins [BR:bbv01004]
 Fatty acid synthase
  Component type
   HMPREF9228_0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AEF26563
Position
173738..174508
Genome map
AA seq 256 aa AA seqDB search
MVNLDGRTAIITGSGKGIGAAVAKCLASHGAAVVINYVHDAASAQRTVEDIHSLGGLAIA
VQADVCDESQSSKLVGTAVDSFGGVDILVNNAFGRFSFDPRRRSTFAGGDWDEFSAQIEG
CLHGAYLMCSHVVPLMRAQTSGRIINISSNLVDSPIVPYHSYITAKGGLVGMTRSLAQEL
GGFGITVNAIAAGLTAGTASSAATTEDVRERIIAMTPLGRLARPDDIAGGVALLASDMAG
FITGQCLHVDGGLTMR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatctggatggcagaacagcgattatcaccggttccggcaagggcataggagcg
gccgtggcgaaatgcctggcatcgcacggagccgctgtcgtcatcaattacgtacatgac
gccgccagcgcgcagcgcactgttgaagacatccactcactgggaggcttggctatagct
gtacaggcggatgtttgcgatgaatcgcaatcttccaagctggtgggtaccgctgtcgac
tcattcggcggcgtggacatcttagtgaataatgctttcggacgcttctcctttgatccg
cgtcgccgttccacttttgctggaggcgattgggatgagtttagcgcacagatcgaggga
tgcctgcatggtgcatatctgatgtgctcacatgtggtgccgctgatgcgagcccagacc
tccgggcgtatcatcaacatctccagcaatctggtcgattcgcccatcgtgccctaccat
tcgtatatcactgccaaaggcggcttggtcggcatgacccgctctctggcccaggagctg
ggcggcttcggcattaccgttaatgccattgccgcaggtttgacggccggaaccgcatcc
agcgcagccaccaccgaggatgttcgtgaacgaatcattgccatgacgcctcttggccgc
cttgcccgtcccgatgacatcgccggaggggtcgcgttgttggcgtccgacatggccggc
ttcattaccgggcaatgtctgcacgtcgatggtggtttgaccatgcgctga

DBGET integrated database retrieval system