KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0134Help
Entry
HMPREF9228_0134   CDS       T01844                                 

Definition
(GenBank) SNARE-like domain protein
  KO
K03975  membrane-associated protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-ProteinID: AEF27732
Position
175444..176169
Genome map
AA seq 241 aa AA seqDB search
MGFVNFILELLKDPRAAIAGWIAMGVAPTLGFIFLIVFIETGVVFFPFLPGDSLLFAAGV
FAAPDAATGKAALPLFWLLPVVWCAPIVGDQCNYFIGHFFGRRIIQSGKVKALTPERLAK
TEHMIEKWGPLAVFLGRFFPFIRTFMPFISGISGMRWSRFTPFSVAGGLCWSTLFTLLGY
FFGNIPAVQDHFELVIVLILLVSLAPTIIGLLKAKFGKKKPESVADSQLDTMESGIENLN
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgttaatttcatcctcgaactgctgaaggatccgcgtgccgcgattgccggt
tggattgccatgggtgtggcgccgaccctcggcttcatcttcctcatcgtatttatcgaa
acgggtgtggtgttcttcccattcctgccgggcgactccctgctgttcgccgccggtgtg
ttcgccgctcccgatgccgcgaccggcaaggctgcgctgccgctgttctggctgctgccg
gtggtctggtgcgccccgattgtcggtgaccagtgcaattacttcattggccacttcttc
ggccgccgcattatccagtccggcaaggtgaaggccttgaccccggagcgtttggccaaa
accgagcacatgattgagaagtggggcccgctggctgtgttcctgggccgtttcttcccg
ttcattcgtacgttcatgccgttcatctccggtatttccggcatgcgttggagccgattc
accccgttctcggtggctggcggcctgtgctggtccacgctgttcacgctgctgggttac
ttcttcggcaatattccggccgtgcaggatcacttcgaattggtgatcgtgctgattctg
ctggtttcgctggctcccaccatcatcggtttgctgaaggccaagttcggcaagaagaag
ccggagtcggttgccgattcccagctggatacgatggaatccggtatcgagaaccttaat
aagtag

DBGET integrated database retrieval system