KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0137Help
Entry
HMPREF9228_0137   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
  KO
K12510  tight adherence protein B
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbv02044]
    HMPREF9228_0137
Secretion system [BR:bbv02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   HMPREF9228_0137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMEM65
Motif
Other DBs
NCBI-ProteinID: AEF27991
Position
178564..179052
Genome map
AA seq 162 aa AA seqDB search
MASAIARMAGGGTLVEAFEEQFGGRFAVRRLTPQRLTDLFERRRLPDESRAQSVRAAMGA
AAAATVSEELGCRAVPCLEAVLDVYSHMRLMQNMRAQAFAVPQATVGLLSALPAIAVVLG
ELMGAHPLLFLFGSQRGLVCLVSGGCCYVVGLVWMRALMRDG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttggcctccgccatcgctcgcatggcaggtggaggaacgctggtggaagcgttcgaggag
caattcggcggacgttttgccgtgcgcaggctgaccccacaacgcctgaccgacttgttt
gagcggcgacgattgccggacgaatcacgcgcgcagtccgtgcgtgccgccatgggcgct
gctgcggcagcgacagtcagcgaggaattgggctgccgtgccgtgccctgcttggaggcg
gtattggatgtctactcgcatatgagattgatgcagaacatgagggcgcaggccttcgcc
gtgcctcaagccacggttggtttgctcagcgcgttgccggcaatcgcggttgtgttgggg
gaattgatgggagctcaccccttgctgttcttgttcggttctcaacgcggcctagtgtgt
ttggtgtcgggcggatgctgctatgtggtcggtctggtttggatgcgcgccctgatgcga
gacggctga

DBGET integrated database retrieval system