KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0140Help
Entry
HMPREF9228_0140   CDS       T01844                                 

Definition
(GenBank) TadE-like protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TadE DUF4244
Motif
Other DBs
NCBI-ProteinID: AEF27286
Position
180327..180707
Genome map
AA seq 126 aa AA seqDB search
MNMRKGLSRWLARLPPVHNEGAATAEFAVVLPSVIAITGVLLTLTRVVAVSMDCQSAATA
SARELVVSDDESAAQQAAVNIVGSRVDVTVHREGSLVRVAVECPVLPGPLNVTPTRVHGE
AVAARQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgagaaaaggtctcagcagatggctcgcccgtttgccgcctgtgcacaatgag
ggtgcggccacggccgagttcgcggtagtgctgcccagcgtcattgcaataacgggggtg
ttgctgacgcttacccgagtggttgcggtatccatggattgccaaagtgccgcaacggca
tccgcgcgtgaattggtggtttctgatgatgaatccgcagcacaacaggctgccgtgaat
attgtgggaagccgagtggatgtgactgtgcatcgggaaggcagcttggtgcgagtggcg
gtcgaatgccccgttttgccagggcctttgaatgtgactcctactcgggtgcatggtgaa
gctgtggctgcgcggcaataa

DBGET integrated database retrieval system