KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0144Help
Entry
HMPREF9228_0144   CDS       T01844                                 

Gene name
dnaX
Definition
(GenBank) DNA polymerase III, subunit gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00230  Purine metabolism
bbv00240  Pyrimidine metabolism
bbv01100  Metabolic pathways
bbv03030  DNA replication
bbv03430  Mismatch repair
bbv03440  Homologous recombination
Module
bbv_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HMPREF9228_0144 (dnaX)
   00240 Pyrimidine metabolism
    HMPREF9228_0144 (dnaX)
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    HMPREF9228_0144 (dnaX)
   03430 Mismatch repair
    HMPREF9228_0144 (dnaX)
   03440 Homologous recombination
    HMPREF9228_0144 (dnaX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbv03032]
    HMPREF9228_0144 (dnaX)
   03400 DNA repair and recombination proteins [BR:bbv03400]
    HMPREF9228_0144 (dnaX)
Enzymes [BR:bbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HMPREF9228_0144 (dnaX)
DNA replication proteins [BR:bbv03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HMPREF9228_0144 (dnaX)
DNA repair and recombination proteins [BR:bbv03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     HMPREF9228_0144 (dnaX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 AAA DNA_pol3_gamma3 RuvB_N AAA_30 zf-CXXC AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: AEF27421
Position
183223..185955
Genome map
AA seq 910 aa AA seqDB search
MALALYRRYRPDTFEGVIGQDQVTVPLMRALDEGRLTHAYLFSGPRGCGKTSSARILARC
VNCAKGPTSHPCGECESCKDLATGGPGSIDVVEIDAASHNGVDDARELRERAGFAPARDR
YKIFILDEAHMVTQQGFNALLKIVEEPPEHVMFIFATTEPDKVIGTIRSRTHHYPFRLVP
QEVMGPYLETICEKESIKPEPGVLKLAMRAGGGSMRDTLSVLDQLMVGSVEGVITHDAAV
ALLGFTPEALIGEAIDAVIDHNGEALYGVIQKVVVGGFDPRRFVEDLLARVRDLLVLTLA
GDRAESVLSDTAEAEDMDDLHRQAKALGLSALTAIADIINTTLGAMTGAISPRMRLELLA
ARLLAGSENGFVAPAAAPALGAPAPATGAVASAAPATGGAAGGFAGASRGGFAGASQGGF
SGASRNRSQSQPQTPANAPAANAGGWNAAGTLNPAGSAGQTGAAGQAAPAQQAMPAAAAP
AAPASPATNAAAPSSDSRSTDEKWNAAVAALPQAIREYVTRDKVPTVAFGPNRKGLPCLS
MTFDKPLSQHAFALAVDNSGKKAAIVVMDAVRQEFGADAVIAPAAVAANGERVESVKRLS
PEQLAKVKQQIAMAKAGLAASSLGAGLGMHSGSEPKAQKPAAEGNAEDADGSHRASGVTP
GGTSNKPDLDDDDPWAKPAASSEAVGEPSASAGEPSVDGFAPSNPDPASAQAPEEHHKKH
VAVPDMSDDVDPWATPAAPVAHAQDATANTQAGQAEQSAASTSSNVGAPAADSAAPTASA
DPWNQPAASAPQAAPDPWNQPAPPQSEPDPWNQPQGQAQRQTPSQSQGIPQSQNSGAADP
WNQSVPPSPQPQVAAEDDEYSMSDQSLGDATAMKMDDLKKLFEVKKVEEFAADDPKNPKN
IQPAKKHTDD
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcactgtatcgtcgctatcgtccggacacctttgaaggtgtgatcggccag
gaccaggtcacggttcctctgatgcgagcccttgacgagggcaggctcacgcatgcctat
ttgttctccggcccgcgaggctgcggcaagaccagttccgcgcgtatcctggcccgttgc
gtcaactgcgccaagggcccaacctcgcatccgtgcggcgagtgtgaaagctgcaaggat
ctggccaccggaggcccgggatccatcgatgtggtcgaaatcgatgccgcctcacacaac
ggtgtggacgatgcccgcgaattgcgcgaacgcgccgggttcgcccccgcccgcgaccgc
tacaagattttcatcctcgacgaggctcacatggtcacgcagcagggcttcaacgcgctg
ctcaagatcgttgaggaaccgcccgagcatgtgatgttcatcttcgctaccaccgaaccg
gacaaggtgattggcaccatccgttcgcgtacccatcattacccgttccgtctggtgccg
caggaggtcatgggcccctatctggaaacgatctgcgagaaagagagcatcaagcctgag
cccggcgtgctgaaactcgcgatgcgtgccggcggcggctccatgcgagacaccctgtcc
gtgttggaccagctcatggtcggttccgtcgagggcgtcatcacccatgatgccgccgtg
gctctgcttggtttcactcctgaagcgttgatcggtgaggccatcgatgcggtcatcgat
cataacggcgaggccctgtacggcgtgatccagaaggtcgtggtcggcgggttcgaccca
cgacgattcgtggaggatctgctggcccgcgtgcgtgacctgctggtgctgactttggcg
ggcgaccgcgcggaatccgtgctgtcagacacggccgaggccgaggacatggacgacctg
caccgccaggccaaggcccttggactgagcgcgctcaccgccattgcggatatcatcaac
accacgctgggtgccatgaccggtgccatctctccgcgtatgcgactcgaattgctggcg
gcccgactgctggccggcagcgaaaacgggttcgttgcacccgctgccgctcccgcattg
ggagctcccgcgccagccacaggagctgtagcctctgccgctcccgctacgggaggtgcg
gcaggaggcttcgctggagcgtctcgcggcggtttcgccggagcctcacagggtggtttc
tccggcgcttcgcgcaaccgatcgcagtcacagccgcagaccccggctaacgctcctgcc
gcaaatgccggtggatggaatgccgctggcacattgaatccagcgggctccgctggccag
acgggtgccgccggtcaagctgcccctgctcagcaggccatgcccgcagccgccgcccct
gctgcgcctgcatctcctgctacgaatgctgcggctccaagctccgactcccgatccact
gatgaaaagtggaatgcagccgttgccgcattgccgcaggccatccgcgaatacgtcacc
agagacaaggtgccgacggtggcattcggccccaaccgtaagggattgccctgcctgtcc
atgaccttcgacaagccactcagccagcatgcgtttgcgctcgcggtggataacagcggc
aaaaaggccgcaatcgtggtgatggatgccgtacgccaggaattcggtgccgatgcggtt
atcgctcctgcggccgttgcggccaacggtgagcgagtggaatccgtcaagcgcctgagc
cccgaacagttggccaaggtcaagcagcagattgcgatggccaaggcgggtctggccgct
tcgagtctgggagctggcctgggcatgcattccggcagtgagccaaaagctcagaagccg
gctgctgaggggaacgccgaagatgcggatggcagccaccgagcctctggcgtaacgccg
ggaggcacttcgaacaagcccgatttggatgatgacgatccatgggccaaacctgccgca
tcgtctgaggctgtgggcgagccatctgcgtctgcaggtgagccgtctgttgatggtttt
gctccgagcaatccagaccctgcatctgcacaggcgcctgaagagcaccacaagaagcat
gtcgccgtgccggacatgagcgatgacgtggacccatgggcaacgccggcagcacctgtc
gcacacgcacaagatgcgaccgccaatacccaggccggccaagctgagcaatccgccgcg
tctacttcctcaaacgtgggtgccccggctgcggattctgctgccccaacggcatccgct
gacccgtggaaccagcctgctgcgtctgcgccgcaagctgcgccggatccatggaatcaa
ccagctcctccgcaatcggaaccggatccgtggaatcaaccgcagggtcaggctcagcgg
cagaccccatcgcagagtcagggtataccgcaaagccagaactcgggcgctgctgacccg
tggaaccagtcagtgccaccgagccctcagccgcaggttgcggccgaggacgatgagtat
tcgatgagcgaccagtcgcttggcgatgccacggccatgaagatggatgatctcaagaag
ctgttcgaggtcaagaaggtcgaggagtttgcggccgatgacccgaagaatccgaagaac
atccagcccgccaagaagcatacggatgactga

DBGET integrated database retrieval system