KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0162Help
Entry
HMPREF9228_0162   CDS       T01844                                 

Definition
(GenBank) ABC transporter, solute-binding protein
  KO
K02055  putative spermidine/putrescine transport system substrate-binding protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv02024  Quorum sensing
Module
bbv_M00193  Putative spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF9228_0162
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbv02000]
    HMPREF9228_0162
Transporters [BR:bbv02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    HMPREF9228_0162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: AEF26850
Position
203488..204612
Genome map
AA seq 374 aa AA seqDB search
MTNIWRKGVTGLLVALLGITMSACGTSSAQSESDTKVGSNLEEITKLAKQEGKLELIGYP
ETWAGYGDSFKAFTKKYGIKIHVSSPDASSAEEIQSIQTLKGQPSQPDVPDLGYSFTDPA
KQKNLLSSYTPSVANELPANLKDPDGKWVGAYYGVLSIGVDESKVPAVTSWKDLLKPVYK
GKIYIGNPREGASQLAAVASAALANGGSLDNIQPGIDFFSKLAKDGYLAKASGTAQALTT
GQAAVVLDWNYNFNGIRDEVEKAGVKLTVNVPTDGVFGNYYAQSALVDAPHPNAARLWLE
WLLSDDGANIYAEHGAIPARFQEMKKVGTLTKEAEAGLPDADTLKRISFPNIEQGNKMSQ
LVVKNWGSQVANFE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatatggcgcaagggtgtcaccggattattggtggcgttgctgggaatcacg
atgtcagcttgcggtacgtcttctgcacaaagtgagtccgacacgaaggtcggttcgaat
cttgaggaaatcaccaagcttgctaagcaagagggtaagctggagttgattggttatccg
gaaacgtgggccggttatggcgattcgttcaaggcattcaccaagaagtatggcatcaag
attcatgtttctagcccggatgcttccagcgcggaagaaatccaaagcatacagaccctc
aaaggacagccttctcagcccgatgttcccgatttgggttattcgttcaccgatccggct
aagcagaagaacttgctgagttcttatacgccgtcggtggccaatgaattgcctgccaat
ctcaaagatccagatggaaaatgggttggcgcatactatggcgtattgagcattggcgtg
gacgaaagcaaagtacctgcagtaaccagttggaaagatctgctcaagcctgtgtacaaa
ggtaagatctatataggaaatcctcgagagggggccagccagctcgctgcagtcgcatcg
gctgcgcttgcgaatgggggttcgttggacaacatccagccgggtattgatttcttctct
aaactcgctaaggatgggtatctcgccaaggctagtggcacggcgcaggctttgaccacc
ggacaggctgctgtggtgcttgattggaattataatttcaacggtatccgtgacgaagtt
gagaaggccggcgtcaagcttacggtcaatgtgccgacggatggtgtatttggcaattat
tatgctcaatccgcgttggtggatgccccgcatccaaacgctgcaaggttgtggcttgag
tggttgctgagcgatgatggtgccaatatttatgctgagcacggcgctatccctgcgcgc
ttccaggagatgaagaaggtcggtactctgaccaaggaagctgaagccggattgcctgat
gccgacacgcttaaacggatcagcttcccgaatatcgagcaaggcaacaagatgtcgcag
ttggtggtcaagaattggggcagtcaagtcgccaatttcgaataa

DBGET integrated database retrieval system