KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0163Help
Entry
HMPREF9228_0163   CDS       T01844                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K02054  putative spermidine/putrescine transport system permease protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv02024  Quorum sensing
Module
bbv_M00193  Putative spermidine/putrescine transport system
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF9228_0163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbv02000]
    HMPREF9228_0163
Transporters [BR:bbv02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter [MD:M00193]
    HMPREF9228_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AEF27643
Position
204703..205551
Genome map
AA seq 282 aa AA seqDB search
MSRTKLIGWLGLLPFAVFMTLFLVIPVLFNFWRSLHDSSGAWSLQPLRGIFAPEYLNAYV
NTIKLSLVTALLGGLLGLLLAWALCTATKPRWLAKIMLSFSAVASQLGGVPLAFAFIALM
GTEGVLTVAIRNVSGVDISKFLDLSSFWGLTVVYLYFQIPLMAVLIMPSILGLKKEWSES
SAALGASPLQTLMRVTIPVLTPAIIGTMLLLFANAFAAYATAYALSGGSANLIAIMVGVF
LTGNVFVDENFGAALIVGMIAIILVAFIMRSVLERRTAKWLQ
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgtacgaaactcattggatggcttggactgctgccattcgcagtattcatgact
ttgtttctggtcatcccagtgttgtttaatttctggcgaagtctacatgatagttccgga
gcatggtcgttgcagccgttgcgaggcatttttgctcctgaataccttaatgcctacgtg
aatactatcaaattatctttggtcactgctttattgggtggcctgttgggtctactgctg
gcatgggcgctttgcacggctaccaagccgcgatggctggccaaaatcatgctctcattt
tcagctgtagcctcccaactaggtggcgttccgctggccttcgcctttattgcattgatg
ggtactgagggagtgttgaccgtggctattcggaatgtcagcggtgtcgatatctcgaag
ttccttgatctgtcctccttctggggattgaccgtggtttatttgtactttcagattcct
ttgatggctgtactgattatgccttctatcctaggtttaaagaaagagtggtcggaatcc
tccgccgcattgggtgccagtcctttgcagacgctgatgcgtgtgaccattccagttctg
acacccgcaataattggcactatgttgcttctgtttgccaatgcctttgctgcctatgca
actgcctatgcgctcagcggagggtcggcgaatcttatcgccattatggtgggcgtcttc
ttgacgggcaacgtattcgtggatgagaattttggtgctgcgctcattgtcggaatgatt
gccatcatcctcgtggccttcatcatgcgttccgtacttgaaaggagaactgcgaaatgg
ctgcagtga

DBGET integrated database retrieval system