KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0166Help
Entry
HMPREF9228_0166   CDS       T01844                                 

Definition
(GenBank) type I phosphodiesterase / nucleotide pyrophosphatase
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphodiest Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AEF27077
Position
207570..208478
Genome map
AA seq 302 aa AA seqDB search
MLLNSASTDKNRHNELRNPQDSAKGLSMQQKLLLIGVDGVRLDIVRKENHAPNINRILNN
GSSAEMTMEVPTISGPGWSSILTGTTHAQHGVQDNTFRGNRLYECPDFLTRAAVAHPMMK
TVAASSWPPLVDPAGPGPVIATRNDQIISCHHRLVVRDGETYGYRLTDSEIARFAVISIS
NDPADASFIYLGEVDEAGHLYGGISEEYESALSRVDEHVGEILDAVERRSSNHPDEDWLV
CITTDHGHLDEGGHGGADPVLRRSFFGALRLGARSSDQYSFESMRPEQIAGWMLRHLDTP
IQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcttaattccgcctctaccgataaaaatcgtcacaacgaattacggaatccacag
gattctgcgaaaggactttctatgcaacaaaaacttctccttattggtgtggacggagta
cgccttgacattgtgcgtaaagagaatcacgcaccgaatatcaatcggatcctcaataat
ggatcttcggctgaaatgacaatggaagtgcctactatatcagggccgggatggtcatcg
atacttacgggcaccactcatgctcagcatggggtgcaggacaacaccttccgtggaaat
cgtttatacgagtgccccgattttctgacacgtgcggctgttgctcatccgatgatgaaa
acggttgccgcttcaagttggcctccattggtggatcctgcaggccctggtccggttatc
gcaacacgcaacgatcagatcatctcttgtcatcaccgtttggtggtacgcgatggtgag
acgtatgggtatcgcctgaccgacagtgaaatcgcacggtttgcggtgatatcgatatct
aacgatcctgcagatgcctccttcatctatcttggtgaggtggatgaggctggtcatctg
tatggtggtattagcgaggaatacgaatctgcgctatcccgtgtggatgagcatgtcggt
gagatccttgatgcagtcgaacgtcgttcgtccaatcatccggatgaggattggctggtg
tgcattacgactgatcatggacatcttgacgaaggtgggcacggcggtgccgatccggtg
ttacgacgttccttcttcggtgcattgcgattaggagctcgctcaagtgatcagtactca
tttgagtctatgcgtcctgaacagattgccggatggatgctgcgacaccttgatacgccg
attcaatga

DBGET integrated database retrieval system