KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0173Help
Entry
HMPREF9228_0173   CDS       T01844                                 

Definition
(GenBank) putative N-acetylmannosamine-6-phosphate epimerase
  KO
K01788  N-acylglucosamine-6-phosphate 2-epimerase [EC:5.1.3.9]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF9228_0173
Enzymes [BR:bbv01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.9  N-acylglucosamine-6-phosphate 2-epimerase
     HMPREF9228_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NanE NMO ThiG TMP-TENI His_biosynth FMN_dh Dus
Motif
Other DBs
NCBI-ProteinID: AEF27462
Position
214138..214806
Genome map
AA seq 222 aa AA seqDB search
MHQAIEKIRGGLVVSCQAYPGEPLRHPETMAQMAMAAVEGGAVGIRCQGLADIAAIKGQV
SVPVIGIWKDGEEGVYITPTLRHARCCAAAGADIIAIDATGRPRPDGLTYAETVRALHDE
GVIVMADCGSFADAERAVEAGTDIISTTLSGYTGERPKTDGPDFELLGQMIEAFPDVPVL
CEGRIHTPDQLHQVMAAGAWAAVVGTAITHPTTITRWFEAKL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggcaatcgagaagatcaggggcggcctcgtggtgagctgccaggcgtacccg
ggcgagccgctgcgccacccggagaccatggcgcagatggccatggcggccgtggagggc
ggggccgtgggcatccgctgccagggcctcgcggacatcgcggccatcaagggccaggtg
agcgtgccggtgatcggcatctggaaggacggcgaggagggcgtgtacatcacgccgacc
ctgcgccatgcccgctgctgtgccgccgccggagcggacatcatcgcgatcgacgcgacc
ggacgcccgcgaccggacgggctgacctacgccgagaccgtgcgcgccctgcacgacgag
ggcgtgatcgtgatggccgactgcggcagcttcgccgacgccgagcgcgccgtggaggcc
ggcaccgacatcatctccaccacgctgtccggctacaccggcgagcgccccaagaccgac
ggtccggacttcgagctgctcggccagatgatcgaggcgttcccggacgtgcccgtgctg
tgcgagggccgcatccacacgcccgaccaactgcatcaggtcatggccgccggcgcgtgg
gccgcggtggtgggcacggcgatcacgcatccgacgaccatcacgcgctggttcgaggcg
aagctgtga

DBGET integrated database retrieval system