KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0174Help
Entry
HMPREF9228_0174   CDS       T01844                                 

Definition
(GenBank) hydrolase, alpha/beta domain protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_2 Peptidase_S9 LCAT FGase Abhydrolase_3 DUF3089 Lipase_3 PGAP1
Motif
Other DBs
NCBI-ProteinID: AEF27850
Position
214803..215639
Genome map
AA seq 278 aa AA seqDB search
MSGAGRILSFIAAGDPNRPLVVLLHGVCDAAIAWSDYIDYLSHDFRVVAVDMLGHGLSPR
YADAQLRHPFESAYEAFEETVEYLEHVHGGRAIMIGHSMGGAIVTMLVRRRPDLCLGAVV
EDPAWLNDEQRQRYVDNAPANAALLHDWASDPANAIRHNQTRRPNWPMEDHIGWAYGQNR
CDPRLELTGVVSFAEDWHQVVSSIEVPLVVVSSDDPSDLVGVRGLEEVRAMGKPNLETVF
IPGCEHGLRRTDIAAFNQAVTPILHRWAACESHVSGEI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggggcggggcgcatactcagcttcattgcagcgggcgatccgaatcgtcccctt
gtcgtcctgctgcacggcgtgtgcgacgcggcgattgcctggtccgactacatcgactat
ctcagtcatgattttcgcgtggttgcggtcgatatgctggggcatggcctgtcgccgcga
tatgccgatgctcaactccgacatccattcgaatccgcgtatgaggcgtttgaggagacc
gttgaatatcttgaacacgtccacggtggcagggcgatcatgatcgggcattccatggga
ggtgcgattgtgacgatgctggtcaggcgtcgtcccgatctttgcctcggtgcagtggtc
gaggatcccgcatggctgaacgatgagcagcgacagcggtatgtggacaacgcgccggcc
aatgcggcgttgctgcacgactgggcatccgacccggccaacgcgatccgtcacaatcag
acgcgtcgtccgaattggccgatggaggatcatatcggctgggcctatgggcagaaccga
tgtgatccgcgattggagctcaccggcgtggtcagcttcgcggaggactggcatcaggtg
gtgtcctcgatagaggtgcccttggtggtggtctcgtccgacgatccctcagatctcgtg
ggtgtgcgcgggctggaggaagtcagggcaatggggaagccgaaccttgaaacggttttc
attcccgggtgtgagcacggtctgcgcaggactgacattgccgcgttcaatcaggcggtt
acgcccatactgcaccgctgggccgcatgtgaatctcatgtttccggcgaaatataa

DBGET integrated database retrieval system