KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0178Help
Entry
HMPREF9228_0178   CDS       T01844                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02032  peptide/nickel transport system ATP-binding protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv02024  Quorum sensing
Module
bbv_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF9228_0178
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbv02000]
    HMPREF9228_0178
Transporters [BR:bbv02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    HMPREF9228_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N MMR_HSR1 RsgA_GTPase oligo_HPY AAA_22 AAA_21 AIG1 AAA_25 AAA_16 PRK Zincin_1 DUF87 RNA_helicase Septin AAA_29
Motif
Other DBs
NCBI-ProteinID: AEF27386
Position
220494..221318
Genome map
AA seq 274 aa AA seqDB search
MSKDPNVPIIELKDVEVVFTTRAGSILHPNKVKAVNKVNLRLMPGKTIGIVGESGCGKST
TANVMCGLQQATSGQVLFKGQDVTHRTAKERMEIGRVVSVVFQDPATALNARMSVIDQLI
DPLVVHKLGDKASRDKHAHELLRMVGLPESALYALPGQLSGGQRQRVAIARALSLNPDAI
IADEPTSALDVSVRAQILNLLSDLKKSLGLSLVFISHDIQTVRYVSDEIVVMNHGTIVER
GAAYDVLNNPQDSYTKLLLGAAPSLLHPTAEECR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggatccgaacgtgccgatcatcgagctcaaggacgtcgaggtggtcttcacc
acccgagccggctcaattctgcatccaaacaaggtcaaggcggtcaacaaggtgaatctg
cgcctgatgccgggcaagaccatcggcatcgttggtgagtccggctgcggcaagtccact
acggccaacgtgatgtgcggcctgcagcaggccacctccggccaggtgctgttcaagggc
caggacgtgacccaccgcaccgccaaggagcgcatggagatcggtcgcgtggtgtccgtg
gtcttccaggacccggccaccgcgctgaatgcccgcatgagcgtcatcgaccagctcatc
gacccgctcgtcgtgcacaagctcggcgacaaggcgagccgagacaagcacgcccacgaa
ttgctgcggatggtgggattgccggagtccgctctgtacgcattgccgggccagctctcc
ggcggccagcgtcagcgcgtcgccatcgcccgcgccctgtcgctcaatccggatgcgatc
atcgccgacgagccgacctccgcgctggacgtgtccgtgcgcgcgcagatcctcaacctg
ttgtcggatctcaagaagtcgctgggtttgtccttggtgttcatcagccatgacatccag
accgtccgctatgtgtccgacgaaatcgtggtgatgaaccacggaaccattgtggagcgc
ggagcggcttacgacgtgctgaacaatccgcaggattcgtacaccaagctgctgctgggc
gccgcgccctcactgctgcacccgaccgcggaggaatgtcggtaa

DBGET integrated database retrieval system