KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0183Help
Entry
HMPREF9228_0183   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
  KO
K07133  uncharacterized protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    HMPREF9228_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_14 DUF4143 UPF0102 NERD HTH_11
Motif
Other DBs
NCBI-ProteinID: AEF27443
Position
226041..227309
Genome map
AA seq 422 aa AA seqDB search
MSDYIARPLAESILHARRKAVILEGARAVGKTMMAQRQLVGVGFSYETLADANAYELAKT
DLHGWLESLNLPVIIDEAQRIRDLPLAVKEIVDALPAGHTQFILTGSALINRGGLDGQDP
LARRAQHFTMSPLTQREMHGVDTSLVDDLWDGEPDVSFDEPIARQKLYDLMAAGGFPEYS
SQYAEYADWERERLVADDIRAVLGDTILPDEKLDAAIAENILTRLLCMPGGILNASALGE
QLALDRRTVDRYVGIFMRRFLVSALPNLRTAPNRQTFARAKIHPVDTSLSVQTMLSKGRD
PMVNPVDYGNLLESFVVNQILPSVQWSRIHPDCFYWRESGSGPKEVDLVMVSRDRIVGVE
VKSSSRVTREDFKGLAALANDQRFYRGYLVYTGGRVMKWPGNLWALPVAALWNTDAFIAA
AE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattacattgcccggcctctggctgaatccatcctgcatgctcgacgcaaggcc
gtgatcctggaaggggctcgcgccgtaggcaagacgatgatggcccagcgccaactcgtc
ggcgtcggcttttcgtatgaaacccttgcggatgccaacgcatacgaactggcgaaaacc
gatctgcatggatggctggagtccttgaacctaccggtgatcatcgatgaggcgcagcgc
atccgcgatctgccgctcgccgtgaaggaaatcgtcgatgcgctgcccgccggccatacg
cagttcatcctcaccggcagcgcgctcatcaaccgaggtggattggacggccaggatcct
ctggcccgtcgagcgcagcatttcaccatgagccccctgactcaacgtgagatgcacggc
gttgacaccagcctggtggacgatttatgggatggagagccggacgtctccttcgacgag
ccgatcgcccgtcagaagctttacgatctcatggccgccggaggcttccccgaatactcg
tcgcaatatgccgaatatgcggattgggaacgagaaagacttgtggcggatgacatccgt
gccgtgctcggcgacaccattctgcccgatgagaaacttgacgcggccatcgccgaaaat
atactcacgaggcttctgtgcatgcccggaggcattctgaatgccagtgctttgggtgag
cagcttgccctcgaccggcgtactgtagaccgttatgtgggcatcttcatgcggcggttt
ctggtgagcgcgttgccgaatctgcgtaccgcgcctaaccgtcagaccttcgctcgtgcc
aaaatccatccggtggatacgtcgctgagcgtacaaaccatgctttccaagggccgcgat
cccatggtcaacccggtggattacggcaatctcctcgagtcgttcgtcgtcaaccagatt
ctgccatctgtgcagtggtcccgcattcatcccgattgcttctattggcgcgaatcaggc
tccggtcccaaggaggtcgatctcgtcatggtaagccgggatcgcattgtcggcgtcgag
gtcaagtcctcctcccgggtaacccgtgaggatttcaaagggctggcggcgttggccaac
gaccagcggttttaccggggctaccttgtgtatacgggtggccgcgtgatgaaatggccg
ggtaatctttgggcattgcctgtggcggcgttatggaataccgacgcatttatagctgcg
gcggagtga

DBGET integrated database retrieval system