KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0185Help
Entry
HMPREF9228_0185   CDS       T01844                                 

Gene name
leuA
Definition
(GenBank) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00290  Valine, leucine and isoleucine biosynthesis
bbv00620  Pyruvate metabolism
bbv01100  Metabolic pathways
bbv01110  Biosynthesis of secondary metabolites
bbv01210  2-Oxocarboxylic acid metabolism
bbv01230  Biosynthesis of amino acids
Module
bbv_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HMPREF9228_0185 (leuA)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    HMPREF9228_0185 (leuA)
Enzymes [BR:bbv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     HMPREF9228_0185 (leuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer DUF4953
Motif
Other DBs
NCBI-ProteinID: AEF26581
Position
230777..232693
Genome map
AA seq 638 aa AA seqDB search
MGQDQSSVFDLAAVAAASNGGNNDPLLPPARFIGDSQKPSRMPYNKYASYSEQIPFDYPE
RTWPGKRLQRAPRWCSVDLRDGNQALVNPMDSERKLRFWNLLVSMGFKEIEVGFPSASET
DFDFIRMLIERELIPDDVTIVVLTQCREHLIRRTYEALKGAKRAIVHFYNSVSVLQREVV
FKKNKEEIKKLATDAAELCKDLESEAKGIDLYYEYSPESFTGTEPEYAVEVCNAVIGVIK
PTPEHPMIINLPATVEMTTPNVFADEVEYVSTHLDDRDSVVLSLHPHNDEGMGVAATELA
VLAGADRVEGCLLGNGERTGNVDLVTLGLNWLTQGIDPQLDLSNVPEIRKTVEYCNQIKI
SERHPYAGNFVFTAFSGSHQDAIKKGLEARQVAAERAGADLDSFVWLVPYLPIDPKDIGR
TYEAIIRVNSQSGKGGMAYLLKTNHNLDLPKRLQIEFDKIVQNFADTTKKEVKDEDIWRL
FKDEYLPVEQSGMTAAGVVVGDTHDASLAPWGRLKLLKVSVSSGEDGSDTVLKARLLDRG
VNVGGEQPVEREVSGIGNGPIAAFLNAISNFGVDASIMDYVEHTMSVGTDAMAASYVECQ
VGEADDAQIVWGVGIDSSITTSALKAIISAINRSQRNR
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaggatcaatcgtccgtgtttgatctcgcggccgtggccgcggcgtccaatggg
gggaacaacgacccgctgctgcctccggcacgattcatcggcgattcgcagaagcccagc
cgtatgccgtacaacaagtacgcctcatacagcgagcagatcccgtttgattacccggag
cgcacgtggccgggtaagcgactgcagcgcgcaccgcgctggtgctccgtcgatcttcgc
gacggcaaccaggccctcgtcaacccgatggattccgagcgcaagctgcgcttctggaac
ctgctcgtctccatgggattcaaggagatcgaggtgggcttcccgtccgcatccgaaacc
gatttcgacttcatccgcatgctcatcgagcgcgagctcatcccggacgatgtgactatc
gtggtgctcacccagtgccgcgagcacctcatccgccgcacctacgaggcgctcaagggc
gccaagcgcgccatcgtgcacttctacaactccgtgtccgtgctgcagcgcgaagtggtg
ttcaagaagaacaaggaagagatcaagaaactcgccaccgatgccgctgaactatgcaag
gacctcgaatccgaggccaagggcatcgacctgtactacgagtactcgccggaatccttc
accggaaccgagccggagtacgccgtcgaggtgtgcaacgccgtgatcggcgtcatcaag
cccacccccgagcatccgatgatcatcaatctgcccgccaccgtggaaatgaccacgccg
aacgtgttcgccgacgaagtggagtacgtctccacccacctcgacgaccgtgattccgtg
gtgctctccctccacccgcacaacgacgaaggcatgggcgtggccgccaccgagctggcc
gtgctggccggcgccgaccgcgtggaaggctgcctgctgggcaacggtgagcgcaccggc
aacgttgacctggtcacgctgggcctcaactggctcacccagggcatcgacccgcaactc
gacctgtccaacgtacctgagatccgcaagacggttgagtactgcaaccagatcaagatt
tccgagcgccatccgtacgccggcaacttcgtgttcaccgcgttctccggctcgcatcag
gacgccatcaagaagggtctcgaggcccgtcaggtggccgccgagcgcgccggcgccgat
ctcgacagcttcgtctggctcgtgccctacctgccgatcgatccgaaggacatcggccgc
acctacgaggccatcatccgcgtcaactcgcagtccggcaagggcggcatggcatacctg
ctcaagaccaaccacaaccttgacctgccgaagcgcctgcagatcgaattcgacaagatc
gttcagaacttcgccgacaccaccaagaaggaagtcaaggacgaggacatctggcgcttg
ttcaaggatgagtacctgccggtcgaacagtctggcatgaccgccgccggcgtggttgtg
ggcgatacccacgacgcttcgcttgcgccttggggccgcctgaagctgctcaaggtgtcc
gtcagctccggtgaggacggttccgacaccgtgctcaaggctcgcctgctcgaccgcggc
gtgaacgttgggggcgagcagcccgtggagcgcgaggtgtccggcatcggcaacggtccg
atcgccgccttcctcaacgccatctccaacttcggcgtggacgcctcgattatggactat
gtggagcacaccatgtccgtgggtaccgacgccatggccgcctcctatgtggaatgccag
gtcggtgaggctgacgacgcgcagatcgtgtggggcgtgggcattgactcgtccattacc
accagcgcgctgaaggcgattatctccgccatcaaccgttcccagcgcaaccgctga

DBGET integrated database retrieval system