KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0187Help
Entry
HMPREF9228_0187   CDS       T01844                                 

Definition
(GenBank) transglycosylase
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AEF27820
Position
complement(232852..235236)
Genome map
AA seq 794 aa AA seqDB search
MFKASSYGGIMASYKRRAHSSDRGPALRKPRATQSKTAGTTKTSSTRGPRGKNNTSRKPA
NTHRASSHKRNGGHRVLKWVLGIFFGLIGLGLAIGIGVFAYLYATTEVPQPEKFALAEKT
TVYYADGTTPIGSYAEQNREIISCEGLPDYVGNAIVASENRTFYTDKGLDLKGIARAFIN
NVTKGTRQGGSTITQQYAERYYMGETTSYVGKAREAIIAIKIAQTESKDEVLCNYMNTIY
LGRNSYGIQAAAKSYFNKDAKDLTLSEAAMIAGIIPSPSTWDPADNPDMAKARFKRVLNI
MQEDGYITAKDHKAAEFPQTADVTQQNEYAGPNGYLLDMVRRELVASKTFTKEDLDTGGY
KIVTTIDKAKQDAMQSVGDTRADGMPESIQVGGIAVEQKTGAVVSVYAGSDYLSQQLNNA
DQAMFEPGSTMKPFALLGAAQSGVNFDTMFNGNSHQHFSGITAEVNNALNINWGNINLYQ
ATANSVNTVFMNVNEHLTPQRTAKIAHEAGIEGEIDTSSMYNVLGINALTVWDLAQGHST
IANNGVKNTLHMVNKVLSSDNKDLYNAPNENKQVFDANDCALVQKAMQGTTTYGTAAGVS
SALGGRQVAGKSGTANDELAASFVGYTPSLLNVWAIWNPDADGNPQVVPAFGGYGVTSTG
YPAHLFEEYMTQALQGTAVEQFTTPKDSGKIGGSDGTWGLGGGQRSSSSTTDDEEAKKQA
EEEAKRKAEEEAKKQADAEAQQKQEFAQQCLANPSYSTECPNYPGTSSGGDGDTGDTTPT
PDDEQKPKPDPQQP
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
ttgttcaaggccagcagttacggtggaatcatggcttcatataaacgtcgtgcacattcg
tcagaccgcggccccgcgctccgtaagcctcgcgccacgcagagcaagactgcaggcacc
acgaaaacaagctctactcgcggccctcgcggcaagaacaacacgagccgcaagccggcc
aacacccatcgcgcatccagccataaaaggaatggcggccaccgtgtgctcaagtgggta
ttgggcatattctttggccttatcggactcggcttggcaatcggtatcggcgtgttcgca
tacctgtatgccaccaccgaggtgccccagcccgagaagttcgccttggcggagaagacc
accgtctattacgccgacggcaccacgccgattggctcatacgccgagcagaaccgcgag
atcatctcttgcgaggggctgccggactatgtgggcaacgccatcgtggcctccgagaac
cgcacgttctacacggataaaggcctggatctcaagggcatcgcccgcgcgttcatcaac
aacgtgaccaagggcacccgtcagggtggctcgaccatcacccagcagtatgccgaacgc
tactacatgggcgaaaccacctcctacgtgggcaaggcccgcgaggccatcatagccatc
aaaatcgcgcagaccgaatccaaggatgaagtgctgtgcaactacatgaatacgatttac
ctaggccgcaattcctacggcatccaggccgccgccaagtcgtatttcaacaaggacgcc
aaggatctgacgctgtctgaagccgcgatgatcgccggcatcatcccctccccctccacg
tgggatccggccgacaaccccgatatggccaaggcccgattcaagcgcgtgctgaacatc
atgcaggaagacggctacatcaccgccaaggatcacaaggccgccgaattcccgcagacc
gccgacgtgacgcagcagaacgaatacgccggccccaacggatacctgctggatatggtg
cggcgtgagctggtggcttccaagacgttcaccaaggaagatcttgacaccggcggatat
aagatcgttaccaccattgacaaggccaagcaggatgcgatgcagtccgtgggagacacg
cgcgcggacggcatgccggagagcattcaggtgggcggcatcgccgtggaacagaagacc
ggcgccgtggtctcggtctacgccggctcggattacctctcgcagcagctcaacaacgcc
gatcaggccatgttcgagccgggttccacgatgaagccgttcgcgctgctgggcgccgcg
cagtccggcgtgaacttcgatacgatgttcaacggcaactcgcaccagcatttctccggc
atcaccgccgaggtcaacaacgccctgaacatcaactggggcaacatcaacctgtaccag
gccaccgccaactcggtgaacacggtgttcatgaacgtcaacgaacaccttacgccgcag
cgcacggcgaaaatcgcgcatgaagcgggcatcgagggagagatcgacaccagctccatg
tataacgtgctgggcatcaacgcgctgaccgtgtgggatctggcgcaggggcattcgacc
atcgccaacaatggcgtgaagaacaccctgcacatggtgaacaaggtgctgagctccgat
aataaggacctctacaacgcacctaacgagaacaagcaggtgttcgacgccaacgattgc
gcgctggtgcagaaggccatgcagggcaccaccacctacggcaccgccgctggcgtgtcc
agcgcgctgggcggccgccaagtggccggcaagtccggtaccgccaacgatgagctggcg
gcatcgttcgtgggttacacgcccagcctgttgaacgtatgggccatttggaatccggat
gcggacggcaacccgcaggttgtgccggcattcggcggctacggcgtcacctccaccggc
tacccggcgcacctattcgaggaatacatgactcaggcgctgcagggcaccgccgttgag
cagttcaccacgcctaaggacagcggcaagattggtggctccgacggcacgtggggcttg
ggcggcggccagagatcctcttcttccaccaccgatgacgaagaggccaagaagcaggcc
gaggaagaagccaagcggaaggccgaggaagaagccaagaagcaggctgatgccgaggcc
cagcagaagcaggaattcgcccaacagtgccttgccaacccgagctattccaccgaatgc
ccgaattatccgggtaccagcagtggcggggacggcgacaccggcgacacgacccccact
cccgacgacgagcagaagcccaagcccgacccgcagcagccgtaa

DBGET integrated database retrieval system