KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0190Help
Entry
HMPREF9228_0190   CDS       T01844                                 

Gene name
topA
Definition
(GenBank) DNA topoisomerase I
  KO
K03168  DNA topoisomerase I [EC:5.99.1.2]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbv03032]
    HMPREF9228_0190 (topA)
   03400 DNA repair and recombination proteins [BR:bbv03400]
    HMPREF9228_0190 (topA)
Enzymes [BR:bbv01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.2  DNA topoisomerase
     HMPREF9228_0190 (topA)
DNA replication proteins [BR:bbv03032]
 Prokaryotic Type
  DNA Topoisomerases
   HMPREF9228_0190 (topA)
DNA repair and recombination proteins [BR:bbv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      HMPREF9228_0190 (topA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Topoisom_bac Toprim_C_rpt Toprim Toprim_4 MAP7
Motif
Other DBs
NCBI-ProteinID: AEF28142
Position
236872..239922
Genome map
AA seq 1016 aa AA seqDB search
MATKLVIVESPTKAHKIGDYLGKGYTVMASVGHIRDLAQPSQVPAADKPKFGKFGVDVND
GFKPYYIVDGDKKRTVSELKSALKGADELYLATDEDREGEAIAWHLVQTLKPKVPVRRMV
FHEITKDAINASLSKTRDVDSHMVDAQETRRILDRLYGYELSPVLWRKVGPGLSAGRVQS
VATRLIVERERERMAFKRAPYWDVVATLAAPDALGERAEFAARMISLGGKRLAGSKDFGS
DGQLTPDGFAGSVHQLDEASATAVAEALKNADFTVMSMETKPYRRRPQPPFTTSTLQQTA
GNRLGMGSRAVMRAAQSLYENGYITYMRTDSVTLSQEAITAARNAVSYHFGDKFLSAEPK
QYATKTAGAQEAHECIRPAGSRFHDPDELASKLPIDQLRLYTLIWQRTLACQMADATGST
ATVRLSAPAGPADGEAVFQASGTVIEFPGFMKATGEGRKPKPAAADAAAADKSGAKATKS
DASESNASLPPMEVGQRVEASDIEPDGHETQPPARYTEATLVKTLEAKEIGRPSTYASII
STIMDRGYVYERGRALIPSWLAFSVTKLLETNFPKLVDYTFTAEMENGLDRIAHGEETGR
DWLTHFYFGSGAGAARNADEAHEGLQQQVAQLGEIDARAINTIDIGDGLHVRVGRYGPYL
EDMEHLDAEGNPKRASLPDTIAPDELTVEVAHDLTDNHSGGPRELGKDPVSGGTVEVRNG
RFGPYVALVPPEGAADSAATAPAGKKSSKKAAAAASRPRMASLFKTMSPESLSLEDALKL
LSLPREVGKYEETNAETGEVSECTVAANNGRYGPYLTKTSADGRSDTRSLGSEDEIFTVD
IDKAKELFAQPKYGRGRGRGAAKPPLRDLGNDPNTGKHVTIKDGRFGAYITDGETNRTVP
RQYTPESIAPEDAFRLLAEKRAAGPSTRGRRGRERAGAAKSGARGAKKGAASAATNAAEA
KRAGRRAEVKKLANKGWSNQRIAEKLSSTAATVKKDVDWLTANEGYERPAVIPKRG
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaagctcgtgattgtggagtccccgaccaaggcccacaaaatcggtgactat
ctgggcaagggatacaccgtcatggcatcggtcggccatattcgcgaccttgcgcaaccc
agccaggtgcccgcggccgataaacccaagttcggcaagttcggcgtggacgtcaacgat
gggttcaagccctactacatcgtggacggcgataagaagcgcacggtaagcgagctgaaa
tccgccctgaagggcgccgacgagctctatctggcgactgatgaggatcgcgagggcgag
gccatcgcatggcatctggtgcagacgctcaagcccaaggtgccggtcaggcgcatggtg
ttccacgagatcaccaaggacgccatcaacgcctcgctgagcaaaacgcgcgatgtcgac
agccatatggtcgacgctcaggagacccgccgtattctcgaccgactctacggctacgag
ctgtccccagtgctgtggcgcaaggtggggccgggcctgtccgccggccgcgtgcagtcc
gtggccacccgactgattgtggagcgcgagcgcgagcgtatggcgttcaagcgtgcgcct
tactgggatgtcgtcgccacgctggccgcgcctgacgctttgggcgagcgcgccgagttc
gcggcccgcatgatctcgttgggcggcaagcgactcgccggatccaaggacttcggctcg
gatggccagctgactcccgatggttttgcgggcagcgttcaccagcttgatgaggcttca
gccaccgccgtggccgaagcgctgaagaatgccgacttcaccgtgatgtcgatggagacc
aagccgtaccgccgccgaccgcagccgccgttcaccacctccaccctgcagcagaccgcg
ggaaatcgcctcgggatggggtctcgcgcagtgatgcgtgcagcacagagcttgtacgag
aacggctacatcacatacatgcgaaccgattcggtgacgctttcacaggaggccatcacc
gccgcccgcaacgccgtctcctaccatttcggcgacaagttcctctccgccgagcccaag
cagtacgccaccaaaaccgctggcgcgcaggaagcccacgagtgtattcgcccggcggga
tcccgattccatgaccccgatgagctggcctccaagctgcccattgaccaactgcgcctg
tacacgctgatctggcagcgcacgctggcatgccagatggccgacgccaccggatcgacc
gccaccgtgcgcctgtctgcgccggctggccccgccgatggtgaggctgtattccaggca
tccggcacagtcatcgaatttcctggctttatgaaggccaccggcgagggccgcaagccc
aaacccgccgcagccgacgcggcggccgccgataagtcgggtgccaaggcgaccaagtcc
gatgcctccgaatccaatgcttccctaccgccgatggaggtgggccagcgggtcgaggct
tccgacatcgagccggatggccacgaaacccagcctccggctcgatacaccgaagccacg
ctggtcaagacgttggaagccaaggagatcggccgcccgtccacctatgccagcatcatc
tccacgattatggatcgcggctatgtgtatgagcgtggccgtgcactgatccccagctgg
ctggcattctccgtgaccaagctgctggaaacgaacttccccaagctggtcgattacacg
ttcaccgctgagatggaaaacggcctcgatcgcattgctcacggcgaggagactggccgg
gattggctgacccacttctactttggctccggcgcgggcgcggcccgcaatgccgacgaa
gcgcatgaaggcctgcagcagcaggtggcccagcttggcgagatcgacgcccgagccatc
aacaccattgacatcggcgacggcctgcatgtgcgcgttggccggtacggcccgtatctg
gaagatatggagcatctggatgccgaaggcaacccgaagcgtgcctccctgccggacacc
atcgcgccggacgagctgaccgtcgaagtggctcatgatctgaccgacaaccattccggt
ggcccgcgcgagctgggcaaggacccggtttccggcggcaccgtggaagtgcgcaacggt
cggttcgggccgtatgtggcgttggtgccgcctgagggtgccgccgattccgccgccact
gcgccggccggcaagaagagctccaagaaggccgcggccgctgcgtcgcgtccgaggatg
gcctcgctgttcaagaccatgagccccgaatcgctctcgttggaagatgcgttgaagctg
ctgagcctgccgcgcgaggtgggcaagtacgaggaaaccaacgccgagaccggtgaggtt
tccgaatgcacggtggccgccaacaacggtcgctatggtccgtatctgaccaagacgagc
gccgacggcaggtcggatacccgttcgttgggctccgaagatgagatcttcaccgtggac
attgacaaggccaaggagctgttcgcccagcccaagtacgggcgtggtcgcggacgtggc
gccgccaagccgccgctgcgtgatttgggcaacgacccgaacaccggcaagcatgtgacc
atcaaggatggccgctttggcgcttacatcaccgatggcgagaccaaccgcacggtgccg
cgccaatacacgccggagtcgattgcgccggaggatgcgttccgtctgcttgccgaaaag
cgcgcggctggaccctccacccgtggccgccgcggccgtgagcgtgccggtgccgcgaag
tcgggagccaggggagccaagaagggcgctgcttcggctgcgaccaatgccgccgaggcc
aagcgcgccggacgccgtgccgaggtgaagaagctggcgaacaagggctggtccaaccag
cgcatcgccgaaaagctcagctccaccgccgccaccgtgaagaaggatgtcgactggctg
accgccaacgagggctacgagcgccccgccgtaattcccaagcgtggctga

DBGET integrated database retrieval system