KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0192Help
Entry
HMPREF9228_0192   CDS       T01844                                 

Definition
(GenBank) DNA polymerase III, delta' subunit
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00230  Purine metabolism
bbv00240  Pyrimidine metabolism
bbv01100  Metabolic pathways
bbv03030  DNA replication
bbv03430  Mismatch repair
bbv03440  Homologous recombination
Module
bbv_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HMPREF9228_0192
   00240 Pyrimidine metabolism
    HMPREF9228_0192
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    HMPREF9228_0192
   03430 Mismatch repair
    HMPREF9228_0192
   03440 Homologous recombination
    HMPREF9228_0192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bbv03032]
    HMPREF9228_0192
   03400 DNA repair and recombination proteins [BR:bbv03400]
    HMPREF9228_0192
Enzymes [BR:bbv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HMPREF9228_0192
DNA replication proteins [BR:bbv03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HMPREF9228_0192
DNA repair and recombination proteins [BR:bbv03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     HMPREF9228_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 AAA AAA_5 AAA_16 AAA_22 IstB_IS21 KTI12 DNApol3-delta_C
Motif
Other DBs
NCBI-ProteinID: AEF27921
Position
240858..242009
Genome map
AA seq 383 aa AA seqDB search
MSVWDSLVGQQPVIDMLSRIAQGDPSQIAQSWLICGPPGSGRSNMARAFAAALESPDHGM
SDEPTRVTQQVLAGTHPDVTVLATNKVTIGIDQVREIITTSEQMPATAPWRIIIIEDVDR
MLERTTNVLLKEIEEPAEHCIWLLCAPSAQDVLPTIRSRTRIVNLAVPSASAVAGFLTAT
TGVEPKVAQRAARLAEGHIGIAKLYATDEQVMTDRDELVVGVLNLARASDAVLLAGNLID
NAKAQAEVDASRTAADQEAEFRRINGLEPGERIPPKLRGAFNQIAKKDDLKRLTTRRTRD
VLDRALNSIASIYRDVAVLQNNAEDSVGLINLENRSAITELSVRLNRAGAVARLDEVAHA
RKRLAGNGNPLLVFESLFCALIP
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtatgggattcgttggtaggccagcagccagtaatcgacatgctcagccgcatc
gcgcagggagacccgagccagatcgcccagtcgtggctgatttgcggccctcccggctcc
gggcgttccaacatggcccgcgcgttcgcggcggcgctggaaagccccgaccacggcatg
agcgatgagcccacgcgcgtcacgcagcaggtactcgccggcacccacccggatgtcaca
gtgctggccaccaacaaagtgaccatcggcatcgaccaggtgcgcgagatcatcaccacc
tccgagcaaatgccagccaccgcaccatggcgcatcatcatcattgaggatgtggaccgc
atgctggagcgcaccaccaacgtgctgctgaaggagatcgaagagccggccgaacactgc
atctggctgctatgcgcgccgagcgcccaggacgtgctgcccaccatccgctcgcgcacg
cgcattgtgaatctcgccgtgccctccgcctcggcagtggccggattcctgactgccacc
acgggcgtcgagccaaaagtcgcccagcgggcggcccgtctggccgagggacacatcggc
atcgccaagttgtacgccactgacgagcaggtgatgacggatcgcgacgaattggtggtg
ggcgtactgaacctcgctcgcgcctcggacgcggtgctgctggccggcaacctcatcgac
aatgccaaggcccaggccgaggtggacgcaagccgcaccgcggccgatcaagaggcggaa
tttcgccgtatcaacggtcttgagccgggggagcggattccgccgaaactgcgcggcgcg
ttcaatcagatcgccaagaaggacgatctcaagcggctgaccacacgacgcacgcgcgat
gtgctcgaccgtgcgctcaactccatcgcctccatttaccgtgatgtggcggtcctgcag
aacaatgcggaggattcggtcgggcttatcaacctggagaatcggtcggccatcactgag
ctgtccgtgcggctgaaccgcgccggcgcggtggcccgactggacgaagtggctcacgcc
cgcaagcgacttgccggtaatggcaacccgctgctggtgtttgaatcgctcttttgcgcg
ttgattccgtga

DBGET integrated database retrieval system