KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0198Help
Entry
HMPREF9228_0198   CDS       T01844                                 

Definition
(GenBank) Raf-like protein
  KO
K06910  uncharacterized protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Brite
KEGG Orthology (KO) [BR:bbv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    HMPREF9228_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP
Motif
Other DBs
NCBI-ProteinID: AEF27084
Position
246845..247447
Genome map
AA seq 200 aa AA seqDB search
MPQTEICNMARDTLVDMKISADFTVIPDDFAKAAAPEYFNGGVPVVSFPFYIDDVNPEAR
YLHWEFVDPDSIPVCGFEWIHWSVANLPIGALMYDFNDSHALAIPPDFSRQLPAMIPETV
QGRNSSASKFLGRSTDPSVIMRYNGPQPPDKDHEYYLQVWATKKPLPGLNQGFWLNELLH
ALRASGETPDTDGIFLTGKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcagactgaaatctgcaacatggctcgcgatacactggtggatatgaagatttcc
gccgatttcaccgtcattccggacgatttcgccaaggccgcggcccctgaatatttcaat
ggtggcgtgcctgtggtctccttcccgttctacatcgatgatgtgaaccccgaagctcgt
tacctgcactgggagttcgtggatccggattcgattccggtctgcggtttcgagtggatt
cactggtccgtggccaacctgcccatcggcgcgctgatgtacgacttcaacgactcacat
gcgctggccattccgccggacttctcccgccagctgccagccatgattccggagaccgtg
caggggcgcaactcctcggcctccaagttcctggggcgtagcactgacccgtcggtgatt
atgcggtacaacggaccgcagccgccggacaaggatcatgagtattatctgcaggtgtgg
gccaccaagaagccgcttcccggattgaatcagggattctggctcaacgaactgctgcac
gcgctgcgtgccagcggcgagacgcccgacaccgacggcatcttcctgaccggcaaggcg
tga

DBGET integrated database retrieval system