KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0200Help
Entry
HMPREF9228_0200   CDS       T01844                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
Pathway
bbv00670  One carbon pool by folate
bbv01100  Metabolic pathways
bbv01120  Microbial metabolism in diverse environments
bbv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HMPREF9228_0200 (fhs)
Enzymes [BR:bbv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     HMPREF9228_0200 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF1611
Motif
Other DBs
NCBI-ProteinID: AEF26404
Position
249306..250823
Genome map
AA seq 505 aa AA seqDB search
MTTIEDFTSQYGLVQKIDAFGYMKYLAENPDAPRKHGKVILVTADTPLKASRGEGKTTTT
IALIDALNKRGIDAAAVLRQPSMGITAAGSKGGASGGGKASLTHPELIDWGLCGEMGAIE
AAQNLLVSFAEKAVDEGKLDTILVPRVSEVPSRSLRSIAVDYGKGNVAEKTVLTPTSELM
QIVVLSRSMDEIAERVSKMIAGTKDGQAVTFGEFVDLWRITGILADAVKPAKTETVNGSP
VYVHGGPFANVSIGIPTLVSVEMACALHDVVVVEAGYGTDAGAQKWLDIACREFGAQWPS
AAIVVTRASTWRDDPELAWRYPFHVQRLENLDIPTFPLINLWEGEDDQVPSLKATADELG
FRTPIIGNLFRDGGEALVPQLDGFVDALENGSMPAEPHSHKGMALAENAKWVAENAYGVP
ADRVIYKPGFTESAAEAMELCQSAGISLYDLAFVAVKSPATMTDNDRAPEAERTVTLKKV
EVHAGAGLVHVNLTTSLTTPMPKIV
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcgaagacttcaccagccagtacggcttggtccagaaaatcgacgcattc
ggctacatgaagtacctggccgagaaccctgatgcgccgcgcaagcacggcaaggtgatc
cttgtcaccgccgatacgccgctcaaggcctcgcgcggtgagggcaagaccaccacgacc
atcgccctgattgacgccctgaacaagcgcggcatcgacgcggccgccgtgctgcgccag
ccgagtatgggcatcaccgcagccggttccaagggcggtgcctccggtggcggcaaggcc
tccctgacccaccccgagctcatcgactggggtctgtgcggtgagatgggcgccatcgag
gcggcccagaacctgctcgtctcctttgccgagaaggccgtggatgagggcaagctcgac
acgattctcgtgccgcgcgtctccgaagtgccgagccgttccctgcgttccatcgctgtg
gactacggcaagggcaacgtggcggagaagacggtgctcacccccacctccgagctcatg
cagattgtggtgctctcccgttccatggacgagattgctgagcgcgtgtccaagatgatc
gccggcaccaaggacggccaggccgtgaccttcggcgagttcgtggacctgtggcgcatc
accggcattctggccgatgcggtcaaacccgccaagaccgagaccgtgaacggttccccg
gtgtacgtgcacggcggcccgtttgccaacgtgtccatcggcattccgacgttggtctcc
gtggagatggcttgcgccctgcatgatgtggtcgtcgttgaggccggttacggcaccgac
gccggcgcccagaagtggctggatatcgcgtgccgtgaattcggtgcgcagtggccgtcc
gccgcgattgtggtgactcgtgcctccacctggcgcgatgatcccgagctggcttggcgc
tacccgttccacgtgcagcgcctggagaacctggacattccgaccttcccgctcatcaac
ctgtgggaaggcgaggacgatcaggttccgtccctgaaggccaccgccgacgagctgggc
ttccgcacgccgatcatcggcaacctgttccgcgatggcggcgaggcgctggttccacag
cttgatggttttgtcgatgcgcttgagaacggctccatgccggctgagccgcactcgcat
aagggcatggccctggcggagaacgccaagtgggtagccgagaacgcctatggtgttccg
gccgatcgcgtgatctacaagccgggcttcaccgagtccgcggccgaggccatggaactg
tgccagtctgctggtatctcgctgtatgatttggccttcgtggcggtcaagtcccctgcg
accatgaccgacaacgaccgcgctccggaggccgagcgcaccgtgaccctgaagaaggtc
gaagtgcacgccggcgccggtctggtccacgtcaacctgactaccagcctcaccaccccc
atgcccaagatcgtgtga

DBGET integrated database retrieval system