KEGG   Bifidobacterium breve ACS-071-V-Sch8b: HMPREF9228_0207Help
Entry
HMPREF9228_0207   CDS       T01844                                 

Definition
(GenBank) hypothetical protein
Organism
bbv  Bifidobacterium breve ACS-071-V-Sch8b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF805 DUF3487
Motif
Other DBs
NCBI-ProteinID: AEF27271
Position
complement(257800..259128)
Genome map
AA seq 442 aa AA seqDB search
MTDPNNGAPAPQYPASNGTPDANNPAEPNTAAPQYGAPAPAYGQLSGNPYGQPAYGQEQP
TQPNPAYSQPHGQPAGAQSAPAYGQPAYGQPNGNPYGQPDGAYGQVPPTYNAYPAPAAAT
GTNAVPLNKPYYGCSFQEAFLRFWKKYVVFRGRASRSEFWWWMLASFAIQVVLSTLVDAS
NDHLSFLSSLWSLAILVPSIALSVRRLHDINKPGWWLAIFYGAVFAGAILMIVGGGAALF
GVLRVWGSPSDSGYYATAAAGSLGILFIGAIIAAAAGIVYIVFMTLPSKPEGARFDDDFA
AAVPYGAPNGYAQAAPGYGDPNAAPYGQAAPTTPAYNPYAQQTAQPVPGHDPYAQSTAPA
VPTAYGQPAPTAPDYSQPATPATYTQPAAAQTPDYGQPAAPASNYGQPATPAPTAEPAVA
PDDSTIPASDNEDDGQKSWQGQ
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcccaacaatggtgcgcccgcgccgcagtatcctgcgtccaacggcacgcct
gacgccaataatccagccgagccgaataccgcggcgccgcagtacggagctcccgcaccc
gcatatggacagctctccggcaacccttacggacagcccgcatatggacaggagcagccg
acgcaacccaacccggcatacagccagcctcacggccaaccagccggcgcgcaatcggct
cccgcctacggccaacctgcgtatggccagcccaatggcaatccctacggtcagcccgat
ggcgcatacggccaagtgccgcccacctacaacgcttaccccgcgcccgcagccgccaca
ggcaccaacgcggttccgctgaacaagccctactacggatgctccttccaggaggcattc
ctgcgtttttggaagaagtacgtggtgttcaggggccgcgcatcccgcagcgaattctgg
tggtggatgctggccagctttgccattcaagtcgtgctgtcaaccctcgtggatgcctcc
aatgaccacctgtcattcctctcttcgctgtggagcctggccatactcgtcccgagcatc
gcactatccgttcgccgtctccacgacatcaacaagcccggctggtggcttgccatcttc
tatggagccgtgtttgctggcgcaatcctcatgattgttggcggcggcgctgcactcttc
ggcgtcctcagagtctggggaagcccctctgacagcggctactatgccacagccgcagcg
ggtagccttggcatcctgttcatcggcgcgataatcgcggccgcagcgggcattgtctac
attgtgttcatgacgctacccagcaagccggaaggcgcgcgttttgacgacgatttcgcc
gcagccgtcccttatggcgctccgaacggctacgctcaggccgcgccgggctatggcgac
ccgaatgccgcgccttacgggcaggccgcaccgaccacaccggcttataatccgtatgcc
cagcagactgctcagcctgtaccgggccacgacccgtacgcgcagtcgactgcaccggcc
gtacctaccgcttacggtcagccggctcccactgcgcccgactacagccagcccgcgaca
cctgccacctacacgcagcccgctgccgcacaaacccctgactatggtcagccggcggct
cccgcttctaactacggacagcccgccacgccagctcctaccgccgagccggctgtcgca
ccggatgattcaaccatcccggcttccgacaacgaggacgacggccagaagtcgtggcaa
ggtcagtga

DBGET integrated database retrieval system